(data stored in ACNUC7421 zone)

EMBL: AP011115.PE174

AP011115.PE174       Location/Qualifiers
FT   CDS             complement(153931..154140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48421"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH2"
FT                   /protein_id="BAH48421.1"
FT                   /translation="MTSIQPAGSGGGGVSGGPRSGSLADVIDKVAVAGICHFRRSLRDL
FT                   DTVASADAGLSRSPSQHRLARRAS"
     MTSIQPAGSG GGGVSGGPRS GSLADVIDKV AVAGICHFRR SLRDLDTVAS ADAGLSRSPS        60
     QHRLARRAS                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page