(data stored in ACNUC7421 zone)

EMBL: AP011115.PE175

AP011115.PE175       Location/Qualifiers
FT   CDS             154172..154399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48422"
FT                   /db_xref="GOA:C1ASH3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH3"
FT                   /protein_id="BAH48422.1"
FT                   /translation="MAGGFARAATACRRRRCLLFLRLLVLVLVTRIGLRFVLGRFLVVL
FT                   GLVGFDNLAIPDLSAPPSISSGWRTDWVMT"
     MAGGFARAAT ACRRRRCLLF LRLLVLVLVT RIGLRFVLGR FLVVLGLVGF DNLAIPDLSA        60
     PPSISSGWRT DWVMT                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page