(data stored in ACNUC7421 zone)

EMBL: AP011115.PE176

AP011115.PE176       Location/Qualifiers
FT   CDS             complement(155001..155600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48423"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH4"
FT                   /protein_id="BAH48423.1"
FT                   /translation="MKIMKARSKVEVAAAVGAGYLLGRTHQLRMAVKIAGAGGRCPMGP
FT                   EDLLAQGSEFLAASPEIADLGDSVRDELLDTAAATAEASSEHVGSFRDRVRSGGAHFVA
FT                   GGGNLVAGVKRIGRRGHAHPRDPEDSTVDGALDHGKGEDGPSSPAVQEERQPKPRRRRK
FT                   PRITTPSDSAGASRDESAPEARPDTAARRKGTAKAH"
     MKIMKARSKV EVAAAVGAGY LLGRTHQLRM AVKIAGAGGR CPMGPEDLLA QGSEFLAASP        60
     EIADLGDSVR DELLDTAAAT AEASSEHVGS FRDRVRSGGA HFVAGGGNLV AGVKRIGRRG       120
     HAHPRDPEDS TVDGALDHGK GEDGPSSPAV QEERQPKPRR RRKPRITTPS DSAGASRDES       180
     APEARPDTAA RRKGTAKAH                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page