(data stored in ACNUC7421 zone)

EMBL: AP011115.PE178

AP011115.PE178       Location/Qualifiers
FT   CDS             complement(156378..156554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48425"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH6"
FT                   /protein_id="BAH48425.1"
FT                   /translation="MCSVGVALDQDVTARGGPPRRMPVVVSSRNHSRWDVARPGVMGAD
FT                   QVAALRVAVLAYL"
     MCSVGVALDQ DVTARGGPPR RMPVVVSSRN HSRWDVARPG VMGADQVAAL RVAVLAYL          58
//

If you have problems or comments...

PBIL Back to PBIL home page