(data stored in ACNUC7421 zone)

EMBL: AP011115.PE183

AP011115.PE183       Location/Qualifiers
FT   CDS             complement(162527..163714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48430"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI1"
FT                   /protein_id="BAH48430.1"
FT                   /translation="MTVEAEEFALSGSCCSSGSEPGLSRRGLLGALGIGAVAAGVAACS
FT                   GPSAGAGAQTGPVSNLDADGPFGPLELVLLGTKAGPPIVPSRAGISTALVIDGATYVID
FT                   CGRSSTTQFARAGLRFDGLRSIFITHLHADHIADYYNYFLLAGSIPNQETRDALANPVS
FT                   VFGPGPAGGLPEKFGGGQAPTVSAEDPTPGLAAFTEKCHDAFAYSSNVFLRDTGIRDIR
FT                   TLVDVHEIAVPDVGASYTMTSPRMDPFPVMEDDHVAVTAVLVPHGPVFPSFAFRFDTAH
FT                   GSVTFSGDTSYSDNLIALARGSDVLVHEAINVQGPNVSLPPAAMDHMLQSHVEVQKVGA
FT                   IARAAGVRTLVLSHLSDFDEEPLDPVRWRKWIEPEFDGEIVIGDDLQRIPIPSSL"
     MTVEAEEFAL SGSCCSSGSE PGLSRRGLLG ALGIGAVAAG VAACSGPSAG AGAQTGPVSN        60
     LDADGPFGPL ELVLLGTKAG PPIVPSRAGI STALVIDGAT YVIDCGRSST TQFARAGLRF       120
     DGLRSIFITH LHADHIADYY NYFLLAGSIP NQETRDALAN PVSVFGPGPA GGLPEKFGGG       180
     QAPTVSAEDP TPGLAAFTEK CHDAFAYSSN VFLRDTGIRD IRTLVDVHEI AVPDVGASYT       240
     MTSPRMDPFP VMEDDHVAVT AVLVPHGPVF PSFAFRFDTA HGSVTFSGDT SYSDNLIALA       300
     RGSDVLVHEA INVQGPNVSL PPAAMDHMLQ SHVEVQKVGA IARAAGVRTL VLSHLSDFDE       360
     EPLDPVRWRK WIEPEFDGEI VIGDDLQRIP IPSSL                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page