(data stored in ACNUC7421 zone)

EMBL: AP011115.PE188

AP011115.PE188       Location/Qualifiers
FT   CDS             165068..166054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48435"
FT                   /db_xref="GOA:C1ASI6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI6"
FT                   /protein_id="BAH48435.1"
FT                   /translation="MDSTIPDENVVRIAVDLACRAPSVHNSQPWQWTYTDGQLDLYTAR
FT                   GRVLASTDPTGRQLVVSCGAALHHLQTALTALKWAADVRRVPEGPHSGHLATIRFRHEA
FT                   RPQSHDFDLLAAIRHRHSDRRPFGPVSVKTPLPAALNDVVHRRDVNLTVLRQEARPTLA
FT                   RATETTAAARKYDTAYQAELHWWAGHSIAQGGIPPDALATADDRDRVDIGRRFPAGLDA
FT                   GATTEPDRSTVLVLSTAADGRGEWLRAGEALSAVLLEATVGGLSTCPLTHMTELRQGRD
FT                   IIRDLLPDRGFPQALIRVGTTEKKSAPRQTPRRPVESVLSVGRRIPH"
     MDSTIPDENV VRIAVDLACR APSVHNSQPW QWTYTDGQLD LYTARGRVLA STDPTGRQLV        60
     VSCGAALHHL QTALTALKWA ADVRRVPEGP HSGHLATIRF RHEARPQSHD FDLLAAIRHR       120
     HSDRRPFGPV SVKTPLPAAL NDVVHRRDVN LTVLRQEARP TLARATETTA AARKYDTAYQ       180
     AELHWWAGHS IAQGGIPPDA LATADDRDRV DIGRRFPAGL DAGATTEPDR STVLVLSTAA       240
     DGRGEWLRAG EALSAVLLEA TVGGLSTCPL THMTELRQGR DIIRDLLPDR GFPQALIRVG       300
     TTEKKSAPRQ TPRRPVESVL SVGRRIPH                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page