(data stored in ACNUC7421 zone)

EMBL: AP011115.PE189

AP011115.PE189       Location/Qualifiers
FT   CDS             complement(166082..166426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48436"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI7"
FT                   /protein_id="BAH48436.1"
FT                   /translation="MNTPIRDFDVEGSTEWTIPALLNETTWLVEVVVDEHDSDEGGSRI
FT                   RAQARLRTRDTRTFVGSGLARRNPDDAEISEIGEVLATARALSDLAHQLIEATAADVET
FT                   ATHSRVHLAG"
     MNTPIRDFDV EGSTEWTIPA LLNETTWLVE VVVDEHDSDE GGSRIRAQAR LRTRDTRTFV        60
     GSGLARRNPD DAEISEIGEV LATARALSDL AHQLIEATAA DVETATHSRV HLAG             114
//

If you have problems or comments...

PBIL Back to PBIL home page