(data stored in ACNUC7421 zone)

EMBL: AP011115.PE190

AP011115.PE190       Location/Qualifiers
FT   CDS             166462..167073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48437"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI8"
FT                   /protein_id="BAH48437.1"
FT                   /translation="MPAGKLRLHGVAVLMPDEEPEPTNVVRSPSLHVRSNELMDQRDLL
FT                   NRFLAEGRRYEIDGFFSDMSDLLGGRLRDAALKRGRLYRLMHGGRGLLLDQTGGLSVAG
FT                   RTSGRPRGGICSVCYPGGSAPPTSEDGRVTFGPGIALPVIAPLYEGRRKTQAAGEGTRT
FT                   PCSNTPPHRRARIVTGGRTNPANSCTCIPRGSRSRWCRGR"
     MPAGKLRLHG VAVLMPDEEP EPTNVVRSPS LHVRSNELMD QRDLLNRFLA EGRRYEIDGF        60
     FSDMSDLLGG RLRDAALKRG RLYRLMHGGR GLLLDQTGGL SVAGRTSGRP RGGICSVCYP       120
     GGSAPPTSED GRVTFGPGIA LPVIAPLYEG RRKTQAAGEG TRTPCSNTPP HRRARIVTGG       180
     RTNPANSCTC IPRGSRSRWC RGR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page