(data stored in ACNUC7421 zone)

EMBL: AP011115.PE191

AP011115.PE191       Location/Qualifiers
FT   CDS             167028..167237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01910"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48438"
FT                   /db_xref="GOA:C1ASI9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI9"
FT                   /protein_id="BAH48438.1"
FT                   /translation="MHPAGFALAVVSGAVTAGLVVLLGAWLATPLVGVGAAATLVATVG
FT                   LAAAMLMPHRPRRRGSGPFRPAAR"
     MHPAGFALAV VSGAVTAGLV VLLGAWLATP LVGVGAAATL VATVGLAAAM LMPHRPRRRG        60
     SGPFRPAAR                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page