(data stored in ACNUC7421 zone)

EMBL: AP011115.PE196

AP011115.PE196       Location/Qualifiers
FT   CDS             complement(171751..172407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48443"
FT                   /db_xref="GOA:C1ASJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ4"
FT                   /protein_id="BAH48443.1"
FT                   /translation="MADMQREKQFRRLRTPRSAAVAGIVFAAFFSASLVLLHTALPADP
FT                   FDETPWVGSGETRIKTALVLAPFAGIAFLWFIGVIRDRLGDLEDRFFATVFLGSGLLFL
FT                   AMGFISMGVAGGVLAIARHSGSSADEIVYFGREIMLQINHVYALRMAAVFMLSLGTIWL
FT                   RTGLMPRFLVVTTYLLALALLLVVSFSLWTTLAFPAWVLLVSIYILVTGRRIRAA"
     MADMQREKQF RRLRTPRSAA VAGIVFAAFF SASLVLLHTA LPADPFDETP WVGSGETRIK        60
     TALVLAPFAG IAFLWFIGVI RDRLGDLEDR FFATVFLGSG LLFLAMGFIS MGVAGGVLAI       120
     ARHSGSSADE IVYFGREIML QINHVYALRM AAVFMLSLGT IWLRTGLMPR FLVVTTYLLA       180
     LALLLVVSFS LWTTLAFPAW VLLVSIYILV TGRRIRAA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page