(data stored in ACNUC7421 zone)

EMBL: AP011115.PE198

AP011115.PE198       Location/Qualifiers
FT   CDS             174413..174883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48445"
FT                   /db_xref="GOA:C1ASJ6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ6"
FT                   /protein_id="BAH48445.1"
FT                   /translation="MRSGEAAACLNVSVVGVRKAASAGRLPSRRTGSGQRVFDRADLDV
FT                   YLGRPTWKNVRADRAEASYCRVSGSTGQKSSLADQEKMLRESATGTVYRVYKDRGSGLR
FT                   ETRTGLNRMLDDATKGRFTVVRVVWRDRLARFSGGVDRTLPVGGRRQGRGPA"
     MRSGEAAACL NVSVVGVRKA ASAGRLPSRR TGSGQRVFDR ADLDVYLGRP TWKNVRADRA        60
     EASYCRVSGS TGQKSSLADQ EKMLRESATG TVYRVYKDRG SGLRETRTGL NRMLDDATKG       120
     RFTVVRVVWR DRLARFSGGV DRTLPVGGRR QGRGPA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page