(data stored in ACNUC7421 zone)

EMBL: AP011115.PE199

AP011115.PE199       Location/Qualifiers
FT   CDS             174920..175681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48446"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ7"
FT                   /protein_id="BAH48446.1"
FT                   /translation="MTSWHCSPRFPAASAQLRSKRNQRRLRWRCGSTVGEDYLMADAGL
FT                   PAVRQFSFTARPYLAVDDVTGEPIGLDGVDTRVGWLLDLISGAEAQMLSRLWQPATFDV
FT                   LAAGVDRQDRRLPAQGHVAASRLGWTPHYPDGVYIPSRVTRVVTAQVMATLRTLAFRDT
FT                   AITSLSERFDPATGQIAPPTCAADWVPLGFARGVRRQLIARSRREGNAVPSGRVRITDM
FT                   QAPPKTSVMARLSAADRQLAQLAVTDVVMTL"
     MTSWHCSPRF PAASAQLRSK RNQRRLRWRC GSTVGEDYLM ADAGLPAVRQ FSFTARPYLA        60
     VDDVTGEPIG LDGVDTRVGW LLDLISGAEA QMLSRLWQPA TFDVLAAGVD RQDRRLPAQG       120
     HVAASRLGWT PHYPDGVYIP SRVTRVVTAQ VMATLRTLAF RDTAITSLSE RFDPATGQIA       180
     PPTCAADWVP LGFARGVRRQ LIARSRREGN AVPSGRVRIT DMQAPPKTSV MARLSAADRQ       240
     LAQLAVTDVV MTL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page