(data stored in ACNUC7421 zone)

EMBL: AP011115.PE200

AP011115.PE200       Location/Qualifiers
FT   CDS             175678..176772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48447"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ8"
FT                   /protein_id="BAH48447.1"
FT                   /translation="MKLPTTPVPTGRAQWRRVRLTATLPAHLHDRPISDWHLPTLVLDH
FT                   RGLLLRCAATETVPAAELTSGTTAVGVDWSPATLGAAAITTETPDGLSSDFQGWTYDDD
FT                   RGLGTKLARLQAEGHMLHRKAARLTQLATNAEPEVRTQLEAKIALLDAHRTAVGAKRGK
FT                   INRELGFHFARQVTDYATAASATVIAVEDLTTLESRGHGRVNNNRAAQSARRKAVIALA
FT                   HTAAGVGITVVSVPARGSSARCPGCDAPLARPGGYHTAWCQGCRVGGNRDHIAGVNRAK
FT                   RALLGKTKVTRRRGQMPAIRVAEHAPVRKSRDKTGPTPRPPRHRRVRRSLPTVTPRAGV
FT                   TPKQICSCTSSVGVGHGPTRTTSE"
     MKLPTTPVPT GRAQWRRVRL TATLPAHLHD RPISDWHLPT LVLDHRGLLL RCAATETVPA        60
     AELTSGTTAV GVDWSPATLG AAAITTETPD GLSSDFQGWT YDDDRGLGTK LARLQAEGHM       120
     LHRKAARLTQ LATNAEPEVR TQLEAKIALL DAHRTAVGAK RGKINRELGF HFARQVTDYA       180
     TAASATVIAV EDLTTLESRG HGRVNNNRAA QSARRKAVIA LAHTAAGVGI TVVSVPARGS       240
     SARCPGCDAP LARPGGYHTA WCQGCRVGGN RDHIAGVNRA KRALLGKTKV TRRRGQMPAI       300
     RVAEHAPVRK SRDKTGPTPR PPRHRRVRRS LPTVTPRAGV TPKQICSCTS SVGVGHGPTR       360
     TTSE                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page