(data stored in ACNUC7421 zone)

EMBL: AP011115.PE201

AP011115.PE201       Location/Qualifiers
FT   CDS             176891..177316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48448"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ9"
FT                   /protein_id="BAH48448.1"
FT                   /translation="MRLTTLGDLPGRIATGSFILHSGLQKWSADEQTAQGIHGMAAGAF
FT                   PFLNAIPPQRFVKLLSVAEISTGAALLAPFVPTAVAGAALTGFSGGLVAMYARTPGLRN
FT                   PGSIWPNENGIAVAKDTWMLGMGLGYVLDGWTRLRSR"
     MRLTTLGDLP GRIATGSFIL HSGLQKWSAD EQTAQGIHGM AAGAFPFLNA IPPQRFVKLL        60
     SVAEISTGAA LLAPFVPTAV AGAALTGFSG GLVAMYARTP GLRNPGSIWP NENGIAVAKD       120
     TWMLGMGLGY VLDGWTRLRS R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page