(data stored in ACNUC7421 zone)

EMBL: AP011115.PE202

AP011115.PE202       Location/Qualifiers
FT   CDS             complement(177345..177881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48449"
FT                   /db_xref="GOA:C1ASK0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK0"
FT                   /protein_id="BAH48449.1"
FT                   /translation="MSVLGQMDSFRRVFPTARRNRADLFRWLRRRPQLLAAVGFHEVAL
FT                   AASARVDPRLKALAEIKAAALTNCEYCLDIGSAFSRALGVSDAQLRALPAFRESSAFDD
FT                   TEKLVLEFADAMTRTPAHISDDLRGSLLAAFSESQVTELAAAIAWENHRGRLNQALGVR
FT                   PSGFSDSDFCAVPEQ"
     MSVLGQMDSF RRVFPTARRN RADLFRWLRR RPQLLAAVGF HEVALAASAR VDPRLKALAE        60
     IKAAALTNCE YCLDIGSAFS RALGVSDAQL RALPAFRESS AFDDTEKLVL EFADAMTRTP       120
     AHISDDLRGS LLAAFSESQV TELAAAIAWE NHRGRLNQAL GVRPSGFSDS DFCAVPEQ         178
//

If you have problems or comments...

PBIL Back to PBIL home page