(data stored in ACNUC7421 zone)

EMBL: AP011115.PE203

AP011115.PE203       Location/Qualifiers
FT   CDS             178008..178193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48450"
FT                   /db_xref="GOA:C1ASK1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK1"
FT                   /protein_id="BAH48450.1"
FT                   /translation="MKAVVCTETRLEFGDVPDPVPARGQVLIDVSRCGICGSDLHARTH
FT                   ADEMAELAAQISAAAL"
     MKAVVCTETR LEFGDVPDPV PARGQVLIDV SRCGICGSDL HARTHADEMA ELAAQISAAA        60
     L                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page