(data stored in ACNUC7421 zone)

EMBL: AP011115.PE204

AP011115.PE204       Location/Qualifiers
FT   CDS             178207..179076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02040"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48451"
FT                   /db_xref="GOA:C1ASK2"
FT                   /db_xref="InterPro:IPR027948"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK2"
FT                   /protein_id="BAH48451.1"
FT                   /translation="MNPNHPRLRWVAPALLLALIYAASLTVYGLSSRTEDEGPFAGNDD
FT                   EVVVLVTAKSLQPTTDRVQAEVTIAVGEEYLHANGDTLNRDITLLLFPSTSHEEIVFRA
FT                   GAAPTTFDTEFIATGNAAYWPFDRFEVNPMVVEAYEGAGADRALLPTGLLVDGRVDGWK
FT                   ARADAVAVDTDLSRNGTGAALLFARTGGNLIYAGILLLMMTILAGLAAFVALQTFRRKR
FT                   AVNTDMLGWMAAMLFAVVPLRGILPGSPPIGSWVDIALTVWVVSTLVASLALFVFCWWR
FT                   DSEQPAQP"
     MNPNHPRLRW VAPALLLALI YAASLTVYGL SSRTEDEGPF AGNDDEVVVL VTAKSLQPTT        60
     DRVQAEVTIA VGEEYLHANG DTLNRDITLL LFPSTSHEEI VFRAGAAPTT FDTEFIATGN       120
     AAYWPFDRFE VNPMVVEAYE GAGADRALLP TGLLVDGRVD GWKARADAVA VDTDLSRNGT       180
     GAALLFARTG GNLIYAGILL LMMTILAGLA AFVALQTFRR KRAVNTDMLG WMAAMLFAVV       240
     PLRGILPGSP PIGSWVDIAL TVWVVSTLVA SLALFVFCWW RDSEQPAQP                   289
//

If you have problems or comments...

PBIL Back to PBIL home page