(data stored in ACNUC7421 zone)

EMBL: AP011115.PE205

AP011115.PE205       Location/Qualifiers
FT   CDS             179127..179579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48452"
FT                   /db_xref="GOA:C1ASK3"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK3"
FT                   /protein_id="BAH48452.1"
FT                   /translation="MVRRTGRVLPPWYLGPVNKVIVGLHRLGVPMPMPALTVPGRETGV
FT                   LRSTPVSPYEVDGRTYVVAGYAESDWAKNARAAGRGELTRGRRRERVRLVPLPVSERAR
FT                   ILREFPIRVPHGVTMFLKAGTVANSSPEAFAAAADRCEVFRVEPLD"
     MVRRTGRVLP PWYLGPVNKV IVGLHRLGVP MPMPALTVPG RETGVLRSTP VSPYEVDGRT        60
     YVVAGYAESD WAKNARAAGR GELTRGRRRE RVRLVPLPVS ERARILREFP IRVPHGVTMF       120
     LKAGTVANSS PEAFAAAADR CEVFRVEPLD                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page