(data stored in ACNUC7421 zone)

EMBL: AP011115.PE206

AP011115.PE206       Location/Qualifiers
FT   CDS             complement(179586..180002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02060"
FT                   /product="putative copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48453"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK4"
FT                   /protein_id="BAH48453.1"
FT                   /translation="MKRVPTLVLPILLAILALAACGNDSDDSSASSESEHGGNHMMTDM
FT                   PSMSMPMSMPAGAREIVISDFKYTLPGTFAPGEQVTVRNDDTAEHTVTADTGDLFDVEV
FT                   EPGAVATFTVPGQPGTFAFHCTYHPNMVGTLEVR"
     MKRVPTLVLP ILLAILALAA CGNDSDDSSA SSESEHGGNH MMTDMPSMSM PMSMPAGARE        60
     IVISDFKYTL PGTFAPGEQV TVRNDDTAEH TVTADTGDLF DVEVEPGAVA TFTVPGQPGT       120
     FAFHCTYHPN MVGTLEVR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page