(data stored in ACNUC7421 zone)

EMBL: AP011115.PE207

AP011115.PE207       Location/Qualifiers
FT   CDS             complement(180112..180822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02070"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48454"
FT                   /db_xref="GOA:C1ASK5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK5"
FT                   /protein_id="BAH48454.1"
FT                   /translation="MPYLERSGDVFVLYFGEEGERDSENAFHPDWIVSVDGLLDRVEQH
FT                   DGPAALVTTAVGKFYSTGLDTAWVLANTDKLNSYIDRVQALFARILTFPLPTVAALTGH
FT                   TFGGGAILAAAHDHRVMREDRGYFCLPGITIGASYAPGSIALLAARLPARAVHTALVTG
FT                   RRYGGVAAKELGFVDEVAPEQQVLADAVAHAQGLVATRGRTLGEIKSSLYADAVVSLRT
FT                   PVANLETQEALNGG"
     MPYLERSGDV FVLYFGEEGE RDSENAFHPD WIVSVDGLLD RVEQHDGPAA LVTTAVGKFY        60
     STGLDTAWVL ANTDKLNSYI DRVQALFARI LTFPLPTVAA LTGHTFGGGA ILAAAHDHRV       120
     MREDRGYFCL PGITIGASYA PGSIALLAAR LPARAVHTAL VTGRRYGGVA AKELGFVDEV       180
     APEQQVLADA VAHAQGLVAT RGRTLGEIKS SLYADAVVSL RTPVANLETQ EALNGG           236
//

If you have problems or comments...

PBIL Back to PBIL home page