(data stored in ACNUC7421 zone)

EMBL: AP011115.PE210

AP011115.PE210       Location/Qualifiers
FT   CDS             182664..184049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02100"
FT                   /product="putative wax ester synthase/diacylglycerol
FT                   acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48457"
FT                   /db_xref="GOA:C1ASK8"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK8"
FT                   /protein_id="BAH48457.1"
FT                   /translation="MSVMSPTEAMFVLFETPSHPMHMGALELFEPPRESGPDHARLMFE
FT                   ALISQEGASDTFRRRAVRPLRGASYPWWSVDDRVDLGYHVRHTAVPGRGRMEDLLSLVS
FT                   QMHGMPLDPQHPMWEIHVIEGLADGRTAVFSKIHLSLMDGPAGLRLLHHALSTDPDARD
FT                   CPAPWTPGVSGTSRRESALPVAAVRAGVRAATSIVGVLPALAKVAYDGVRDQHLTLPLQ
FT                   SPPTMLNVPVGRARKLAARSWPIRRLVSVAAAARTTINAVVLAMCSGALRHYLVEQYAL
FT                   PEAPLTAMLPVPLDLGGTMIGPRGRDHGVGAMVVGLATDEADPAARLARISESVEHTNR
FT                   VFGALSHTQFQVMSALAISPILLEPVRRFVDDTPPPFNVMISYMPGPSRPRYWNGARLD
FT                   AVYPAPTVLGGQALSITLTSRSGQLDVGVVGDRQAVPHLQRIITHLETSLTDLENAVAA
FT                   SGT"
     MSVMSPTEAM FVLFETPSHP MHMGALELFE PPRESGPDHA RLMFEALISQ EGASDTFRRR        60
     AVRPLRGASY PWWSVDDRVD LGYHVRHTAV PGRGRMEDLL SLVSQMHGMP LDPQHPMWEI       120
     HVIEGLADGR TAVFSKIHLS LMDGPAGLRL LHHALSTDPD ARDCPAPWTP GVSGTSRRES       180
     ALPVAAVRAG VRAATSIVGV LPALAKVAYD GVRDQHLTLP LQSPPTMLNV PVGRARKLAA       240
     RSWPIRRLVS VAAAARTTIN AVVLAMCSGA LRHYLVEQYA LPEAPLTAML PVPLDLGGTM       300
     IGPRGRDHGV GAMVVGLATD EADPAARLAR ISESVEHTNR VFGALSHTQF QVMSALAISP       360
     ILLEPVRRFV DDTPPPFNVM ISYMPGPSRP RYWNGARLDA VYPAPTVLGG QALSITLTSR       420
     SGQLDVGVVG DRQAVPHLQR IITHLETSLT DLENAVAASG T                           461
//

If you have problems or comments...

PBIL Back to PBIL home page