(data stored in ACNUC7421 zone)

EMBL: AP011115.PE211

AP011115.PE211       Location/Qualifiers
FT   CDS             complement(184057..185127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48458"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK9"
FT                   /protein_id="BAH48458.1"
FT                   /translation="MTTLHSRSASGTAPQAGTSMPCPAPRGPVSGLLFPILRGDTAEAE
FT                   PFVTAALALASAERDDPRAFLFDEDAQICLTALYELHLQGIAGVDDRWEWDSDLIFARS
FT                   ALEVPFDAAIRALADPPTAVGDVVAALWEMTAPSTAPGLSGYMAHDADLSQFRELLIHR
FT                   SLNQLREADVHTLGIPRLAGAPKAALVEVQSDEYGGGRPERMHSALFATTMRELGLSDG
FT                   YAHYVDAVPAVTLASLNALSLFGLHRSRLGALVGHLCAVETTSALPSKKYAAGLRRLGF
FT                   GKAATLFFDEHVEADSVHEQIVCRDLAGGLVAARPAAADDVLLGAAACLAFDDLVGDHV
FT                   TRCWERNRTSLRQPAG"
     MTTLHSRSAS GTAPQAGTSM PCPAPRGPVS GLLFPILRGD TAEAEPFVTA ALALASAERD        60
     DPRAFLFDED AQICLTALYE LHLQGIAGVD DRWEWDSDLI FARSALEVPF DAAIRALADP       120
     PTAVGDVVAA LWEMTAPSTA PGLSGYMAHD ADLSQFRELL IHRSLNQLRE ADVHTLGIPR       180
     LAGAPKAALV EVQSDEYGGG RPERMHSALF ATTMRELGLS DGYAHYVDAV PAVTLASLNA       240
     LSLFGLHRSR LGALVGHLCA VETTSALPSK KYAAGLRRLG FGKAATLFFD EHVEADSVHE       300
     QIVCRDLAGG LVAARPAAAD DVLLGAAACL AFDDLVGDHV TRCWERNRTS LRQPAG           356
//

If you have problems or comments...

PBIL Back to PBIL home page