(data stored in ACNUC7421 zone)

EMBL: AP011115.PE215

AP011115.PE215       Location/Qualifiers
FT   CDS             complement(187482..188252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48462"
FT                   /db_xref="GOA:C1ASL3"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL3"
FT                   /protein_id="BAH48462.1"
FT                   /translation="MSETAGERPESMSPDLDGGTIAAQLGSLATALDEFNWNSGSQVEM
FT                   GLLLQRVCEQVVDAIADADMAGVSLLRDGLVETVAYADETVRQIDIQSFQAIDGDDYFG
FT                   VAGSRKVVKATRGEAAARWPSLADNLDQAGMRSFLSAPLAVDEALAGTLDIYGRGDHGF
FT                   SELDAVVLLVYTTAIEGLLRSARSVELARNEVTGLTRAMKTRAVIEQAKGIVMALRGVS
FT                   ADRAFEILVAQSQQEHVKLAEVARRIVESVTNPE"
     MSETAGERPE SMSPDLDGGT IAAQLGSLAT ALDEFNWNSG SQVEMGLLLQ RVCEQVVDAI        60
     ADADMAGVSL LRDGLVETVA YADETVRQID IQSFQAIDGD DYFGVAGSRK VVKATRGEAA       120
     ARWPSLADNL DQAGMRSFLS APLAVDEALA GTLDIYGRGD HGFSELDAVV LLVYTTAIEG       180
     LLRSARSVEL ARNEVTGLTR AMKTRAVIEQ AKGIVMALRG VSADRAFEIL VAQSQQEHVK       240
     LAEVARRIVE SVTNPE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page