(data stored in ACNUC7421 zone)

EMBL: AP011115.PE223

AP011115.PE223       Location/Qualifiers
FT   CDS             192157..192480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02230"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48470"
FT                   /db_xref="GOA:C1ASM1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM1"
FT                   /protein_id="BAH48470.1"
FT                   /translation="MTYQPDNGPSRELNSEFRPQDDAHTMRNHVGEAITDGRNWPGYIL
FT                   IATGIAVLGLTLVAAGYGFEGWALIGGIACVLCLVLGTVLVLLERRRVKALEGETLTDQ
FT                   EGH"
     MTYQPDNGPS RELNSEFRPQ DDAHTMRNHV GEAITDGRNW PGYILIATGI AVLGLTLVAA        60
     GYGFEGWALI GGIACVLCLV LGTVLVLLER RRVKALEGET LTDQEGH                     107
//

If you have problems or comments...

PBIL Back to PBIL home page