(data stored in ACNUC7421 zone)

EMBL: AP011115.PE224

AP011115.PE224       Location/Qualifiers
FT   CDS             192477..193058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48471"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM2"
FT                   /protein_id="BAH48471.1"
FT                   /translation="MTDPKADLHDYLQAARDALLWKLDGLSEYDIRRPMTATGTNLLGL
FT                   IKHLTGVEIGYFGEPFGRGVDFPPWVTDDAEDNVDMWATADESRDYVVGQYRQAWEHTD
FT                   ATVRALPIDAPGRIRHWPEDRRDVTLHRILVHVIAETHRHAGHADIVRELVDGTAGLRA
FT                   DNDNLPTAERTWWESYRARVERAAREAGQG"
     MTDPKADLHD YLQAARDALL WKLDGLSEYD IRRPMTATGT NLLGLIKHLT GVEIGYFGEP        60
     FGRGVDFPPW VTDDAEDNVD MWATADESRD YVVGQYRQAW EHTDATVRAL PIDAPGRIRH       120
     WPEDRRDVTL HRILVHVIAE THRHAGHADI VRELVDGTAG LRADNDNLPT AERTWWESYR       180
     ARVERAAREA GQG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page