(data stored in ACNUC7421 zone)

EMBL: AP011115.PE225

AP011115.PE225       Location/Qualifiers
FT   CDS             complement(193065..194798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48472"
FT                   /db_xref="GOA:C1ASM3"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM3"
FT                   /protein_id="BAH48472.1"
FT                   /translation="MKRRVSARKVAHRRRIAGSLVAPGALGLAALLATPWSNPGSPATT
FT                   ATALTAAASDACYDMVSIAVAGRGDSPRPGTHQMLVAPDGTPLPASYSSNYTSPWIDEV
FT                   VNAPQQSVGGGSYAAVYIEYPANMNSYEDAVNAGVDNTETVMRSIHASCPDTKFSIVGY
FT                   SEGADVARRVAMEVGNQDGQDGSYDILDPASVVGVVILADAGRNLGEGAFPGAENEFRN
FT                   PDGFDLAYQSGQTSTSGRGALPGTSGSFGALDGKVASFCSEGDLTCSAPENIALLQLAI
FT                   NVGRQLNVDALQKEGLTPATGQDLAVVLGQIALAAFADIQSQDNWMQSDETFLDVLVKV
FT                   SDPAYKPADPVAAQSDTPTGPISSNQAVDLVYLPTKVRNEIIGFIADNQNTIQVAMSDP
FT                   YQQTLGEGTGHHFDYWRDANAGNGRPLTSAQYAAAWLTHLAQEAEKGEARSAASQQATA
FT                   KLAAASTPDTEAAQVAPTTTAGAKKPALASDAVSATTTTTGSPAPTTVASTTSPEPTTA
FT                   EPTTAVEVATPNTTSPPAAQAVSESSAVATTTAEPAASTATESATTTPVVTTTTVQPAA
FT                   G"
     MKRRVSARKV AHRRRIAGSL VAPGALGLAA LLATPWSNPG SPATTATALT AAASDACYDM        60
     VSIAVAGRGD SPRPGTHQML VAPDGTPLPA SYSSNYTSPW IDEVVNAPQQ SVGGGSYAAV       120
     YIEYPANMNS YEDAVNAGVD NTETVMRSIH ASCPDTKFSI VGYSEGADVA RRVAMEVGNQ       180
     DGQDGSYDIL DPASVVGVVI LADAGRNLGE GAFPGAENEF RNPDGFDLAY QSGQTSTSGR       240
     GALPGTSGSF GALDGKVASF CSEGDLTCSA PENIALLQLA INVGRQLNVD ALQKEGLTPA       300
     TGQDLAVVLG QIALAAFADI QSQDNWMQSD ETFLDVLVKV SDPAYKPADP VAAQSDTPTG       360
     PISSNQAVDL VYLPTKVRNE IIGFIADNQN TIQVAMSDPY QQTLGEGTGH HFDYWRDANA       420
     GNGRPLTSAQ YAAAWLTHLA QEAEKGEARS AASQQATAKL AAASTPDTEA AQVAPTTTAG       480
     AKKPALASDA VSATTTTTGS PAPTTVASTT SPEPTTAEPT TAVEVATPNT TSPPAAQAVS       540
     ESSAVATTTA EPAASTATES ATTTPVVTTT TVQPAAG                                577
//

If you have problems or comments...

PBIL Back to PBIL home page