(data stored in ACNUC7421 zone)

EMBL: AP011115.PE226

AP011115.PE226       Location/Qualifiers
FT   CDS             195299..196024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48473"
FT                   /db_xref="GOA:C1ASM4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM4"
FT                   /protein_id="BAH48473.1"
FT                   /translation="MSNDPSEAAHVGRDSPSAVFAKLAEMVYNGDDFDHVYQAICDAAA
FT                   TLVPGCAHASLMLKQKDRHITVAASDEVAAHVDALERAEQEGPCLDAIENDAPQVEAEL
FT                   ARSTQWPRLARRAIAETPVRGAAGFRLLIHGRKVGALNLFADNPGEFTDESIDQAILIT
FT                   AFAAVTLTALHEHQEAQTLRDGLASNREIGKAIGLLMAFHDISEDRAFELLRKTSQDMN
FT                   IKLTSVAREVIVHHNSKFD"
     MSNDPSEAAH VGRDSPSAVF AKLAEMVYNG DDFDHVYQAI CDAAATLVPG CAHASLMLKQ        60
     KDRHITVAAS DEVAAHVDAL ERAEQEGPCL DAIENDAPQV EAELARSTQW PRLARRAIAE       120
     TPVRGAAGFR LLIHGRKVGA LNLFADNPGE FTDESIDQAI LITAFAAVTL TALHEHQEAQ       180
     TLRDGLASNR EIGKAIGLLM AFHDISEDRA FELLRKTSQD MNIKLTSVAR EVIVHHNSKF       240
     D                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page