(data stored in ACNUC7421 zone)

EMBL: AP011115.PE227

AP011115.PE227       Location/Qualifiers
FT   CDS             196338..196670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48474"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM5"
FT                   /protein_id="BAH48474.1"
FT                   /translation="MTVEFAAEADATVGRISGEIDVLAAPSFALALARLTDGVSSARVI
FT                   VDMTAVDFVGTSGLSILSEFAESARRQHITWALAGNRAVLRPIEAIGLSATIPTCSTLH
FT                   DAVDRV"
     MTVEFAAEAD ATVGRISGEI DVLAAPSFAL ALARLTDGVS SARVIVDMTA VDFVGTSGLS        60
     ILSEFAESAR RQHITWALAG NRAVLRPIEA IGLSATIPTC STLHDAVDRV                  110
//

If you have problems or comments...

PBIL Back to PBIL home page