(data stored in ACNUC7421 zone)

EMBL: AP011115.PE228

AP011115.PE228       Location/Qualifiers
FT   CDS             196701..197372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48475"
FT                   /db_xref="GOA:C1ASM6"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM6"
FT                   /protein_id="BAH48475.1"
FT                   /translation="MPGKQPTRGRSTSGAGETVRMLLDKAGPTYASASHITLKDTPTPL
FT                   FQLLTLSLLLSTRISSEIAVSAARELFRARLRSPRAMREADRRTVISALGRGNYVRYDE
FT                   STATRLHAAAVRVDEEYGGDLRRLASACDHATSAAVRLLTEFDGIGPVGADIFLREVQD
FT                   VWSWVRPYFDTRARESARDLGLPDDPHALYDLAPPGRVAELAAALVRVSLDSQLRDEVR
FT                   G"
     MPGKQPTRGR STSGAGETVR MLLDKAGPTY ASASHITLKD TPTPLFQLLT LSLLLSTRIS        60
     SEIAVSAARE LFRARLRSPR AMREADRRTV ISALGRGNYV RYDESTATRL HAAAVRVDEE       120
     YGGDLRRLAS ACDHATSAAV RLLTEFDGIG PVGADIFLRE VQDVWSWVRP YFDTRARESA       180
     RDLGLPDDPH ALYDLAPPGR VAELAAALVR VSLDSQLRDE VRG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page