(data stored in ACNUC7421 zone)

EMBL: AP011115.PE229

AP011115.PE229       Location/Qualifiers
FT   CDS             complement(197622..197843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02290"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48476"
FT                   /db_xref="GOA:C1ASM7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM7"
FT                   /protein_id="BAH48476.1"
FT                   /translation="MIRTTVQQHDQRTMSPPAEEPAAKHTLRPTVYIASISAATATAPA
FT                   IVVTGSILVAVATSVTVLAAVALAALLI"
     MIRTTVQQHD QRTMSPPAEE PAAKHTLRPT VYIASISAAT ATAPAIVVTG SILVAVATSV        60
     TVLAAVALAA LLI                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page