(data stored in ACNUC7421 zone)

EMBL: AP011115.PE230

AP011115.PE230       Location/Qualifiers
FT   CDS             complement(198083..199066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02300"
FT                   /product="putative metal ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48477"
FT                   /db_xref="GOA:C1ASM8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM8"
FT                   /protein_id="BAH48477.1"
FT                   /translation="MDVRFVSDDGVRSCAATELKELLDRPDGLVWVDIPTWDDQAHDTL
FT                   TTVFDCHPLAVRDSKNRNQVPKVHRYVDQLFVVLHAPQSGAHGHVHYVELDQFIGARYL
FT                   VTVHGPVNPAIDPSTAMVEVNVVLSRLESGKLRPGTAFELSFALLAALTARMRAYTAEL
FT                   TKDVWKLEQQVTGGHLGDPETFLDEMFRVRHGLLTVGTMAALSGEVYGRMVTIEAFGAG
FT                   KGQDLLLDAVDQFQHLTVMARGQKDYLQGTIEFYQARTNTKMTIAAERLAVIAAVTLPI
FT                   TALSSIIGMNVIVNERTQWPAVAVIVLVMLAMSGALLVWAKRKGWF"
     MDVRFVSDDG VRSCAATELK ELLDRPDGLV WVDIPTWDDQ AHDTLTTVFD CHPLAVRDSK        60
     NRNQVPKVHR YVDQLFVVLH APQSGAHGHV HYVELDQFIG ARYLVTVHGP VNPAIDPSTA       120
     MVEVNVVLSR LESGKLRPGT AFELSFALLA ALTARMRAYT AELTKDVWKL EQQVTGGHLG       180
     DPETFLDEMF RVRHGLLTVG TMAALSGEVY GRMVTIEAFG AGKGQDLLLD AVDQFQHLTV       240
     MARGQKDYLQ GTIEFYQART NTKMTIAAER LAVIAAVTLP ITALSSIIGM NVIVNERTQW       300
     PAVAVIVLVM LAMSGALLVW AKRKGWF                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page