(data stored in ACNUC7421 zone)

EMBL: AP011115.PE231

AP011115.PE231       Location/Qualifiers
FT   CDS             199173..199586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48478"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM9"
FT                   /protein_id="BAH48478.1"
FT                   /translation="MADNRTGLIVVDAANVVGSRPDGWWRDRAGAARRLLVQLDALEQH
FT                   LDQPAEVVVVIEGAAKAAVAGDPNRELNGLRVVSAHGSGDDAIVDVVAAEKDGERQITV
FT                   VTADRGLRARVEALGAVTVGPRWLFARIDAASS"
     MADNRTGLIV VDAANVVGSR PDGWWRDRAG AARRLLVQLD ALEQHLDQPA EVVVVIEGAA        60
     KAAVAGDPNR ELNGLRVVSA HGSGDDAIVD VVAAEKDGER QITVVTADRG LRARVEALGA       120
     VTVGPRWLFA RIDAASS                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page