(data stored in ACNUC7421 zone)

EMBL: AP011115.PE233

AP011115.PE233       Location/Qualifiers
FT   CDS             complement(201217..201729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48480"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN1"
FT                   /protein_id="BAH48480.1"
FT                   /translation="MTHVFDRVAEGKREESVQYSFEGVVVIEAHRDTSASASEVWSVLA
FT                   NGWLYPSWVVGATRMRAVSADWPAVGSRLHHSVGSWPALIDDSTEVLFAEENRELRLLA
FT                   QVSPTKAVVRLRLEPRESGCHLEMSEAAASAPLTWVPRIAQDLAVLPRNLECLRRLSFL
FT                   AERNTKP"
     MTHVFDRVAE GKREESVQYS FEGVVVIEAH RDTSASASEV WSVLANGWLY PSWVVGATRM        60
     RAVSADWPAV GSRLHHSVGS WPALIDDSTE VLFAEENREL RLLAQVSPTK AVVRLRLEPR       120
     ESGCHLEMSE AAASAPLTWV PRIAQDLAVL PRNLECLRRL SFLAERNTKP                  170
//

If you have problems or comments...

PBIL Back to PBIL home page