(data stored in ACNUC7421 zone)

EMBL: AP011115.PE240

AP011115.PE240       Location/Qualifiers
FT   CDS             205986..206438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48487"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN8"
FT                   /protein_id="BAH48487.1"
FT                   /translation="MFVLLRHAHAIGQQDWTASDALRPLSDLGRDQATGLIGTLAGVDL
FT                   HVLYCSPTTRCLDTLAPLAAARGLHVQEHPLLAPDAATDELCAALDAIDLAGTLWCTHG
FT                   EILTALAAITRADGTPAFPIGHTAKGGAWLLNARTPLRYLDPDPPQ"
     MFVLLRHAHA IGQQDWTASD ALRPLSDLGR DQATGLIGTL AGVDLHVLYC SPTTRCLDTL        60
     APLAAARGLH VQEHPLLAPD AATDELCAAL DAIDLAGTLW CTHGEILTAL AAITRADGTP       120
     AFPIGHTAKG GAWLLNARTP LRYLDPDPPQ                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page