(data stored in ACNUC7421 zone)

EMBL: AP011115.PE244

AP011115.PE244       Location/Qualifiers
FT   CDS             complement(210421..211026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02440"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48491"
FT                   /db_xref="GOA:C1ASP2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP2"
FT                   /protein_id="BAH48491.1"
FT                   /translation="MRSAHGCGDRSFENSGLDMSDGSVERDQDDEWNYRARHETETQRL
FT                   DRNWAALLQELRVVQTGVQLLTGFLLTLPFQQRFTDLTDFEVIVYLMTVALSVLSTMLL
FT                   VAPAGFHRVLFRRHALPALVSAAHKLTVCGIATFGAALVGVVLLIFSFVVSPRVGLVAA
FT                   VVAAGIFCGLSVLAAILRLRNRVDDDPPTSDQRRSDRD"
     MRSAHGCGDR SFENSGLDMS DGSVERDQDD EWNYRARHET ETQRLDRNWA ALLQELRVVQ        60
     TGVQLLTGFL LTLPFQQRFT DLTDFEVIVY LMTVALSVLS TMLLVAPAGF HRVLFRRHAL       120
     PALVSAAHKL TVCGIATFGA ALVGVVLLIF SFVVSPRVGL VAAVVAAGIF CGLSVLAAIL       180
     RLRNRVDDDP PTSDQRRSDR D                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page