(data stored in ACNUC7421 zone)

EMBL: AP011115.PE245

AP011115.PE245       Location/Qualifiers
FT   CDS             211185..211454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP3"
FT                   /protein_id="BAH48492.1"
FT                   /translation="MRSSQRARTKLTRVDTGEHHLFMNSAEEARQILQVTTRLITKFPA
FT                   VPRESVEAAVQDAVVQFEGGRIRDFVPLLIERTATANLVSSVNA"
     MRSSQRARTK LTRVDTGEHH LFMNSAEEAR QILQVTTRLI TKFPAVPRES VEAAVQDAVV        60
     QFEGGRIRDF VPLLIERTAT ANLVSSVNA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page