(data stored in ACNUC7421 zone)

EMBL: AP011115.PE247

AP011115.PE247       Location/Qualifiers
FT   CDS             complement(212114..212887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48494"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR17"
FT                   /protein_id="BAH48494.1"
FT                   /translation="MGNGTRFRDTPVAARGTPEEVWQSWLGSVHCPPIPLKDCDRMVVV
FT                   APHPDDEVLGVGALMATTATAGVPVQVVAVTDGGASHPQSPTLPPAALAAARIAESNRA
FT                   TALLGVGEPLRFGLPDGGVSAHEHELTTRLVDVLTATCRAGERVWVLATWRGDGHPDHE
FT                   ATGRAAAEACSITGHRMVEYPVWMWHWARPGEASVPWNRIRVLAPTADILARKRRAVDE
FT                   FRTQILPLSDDPRDAAILPPWVLARLMRPTERVLW"
     MGNGTRFRDT PVAARGTPEE VWQSWLGSVH CPPIPLKDCD RMVVVAPHPD DEVLGVGALM        60
     ATTATAGVPV QVVAVTDGGA SHPQSPTLPP AALAAARIAE SNRATALLGV GEPLRFGLPD       120
     GGVSAHEHEL TTRLVDVLTA TCRAGERVWV LATWRGDGHP DHEATGRAAA EACSITGHRM       180
     VEYPVWMWHW ARPGEASVPW NRIRVLAPTA DILARKRRAV DEFRTQILPL SDDPRDAAIL       240
     PPWVLARLMR PTERVLW                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page