(data stored in ACNUC7421 zone)

EMBL: AP011115.PE248

AP011115.PE248       Location/Qualifiers
FT   CDS             complement(212890..213855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48495"
FT                   /db_xref="GOA:C1AR18"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR18"
FT                   /protein_id="BAH48495.1"
FT                   /translation="MSTDVTHDSTPTSAAVRAIIRSGEAELPLPGDGSTAVRWGRLTEW
FT                   CRRDLSIGRLLEAHADADAILAEIDGTRAGRNEWWGVWASEPPQPVLDAAHDSSGWRLR
FT                   GTKAWCSGASMCTHALITARVDGRPRLFAVDLREPGVTPGRGGWRNPGMAATDTEAVTF
FT                   DSVPARPVGSADRYLDRAGFWHGGIGVAACWFGGALAVAEPLRVRARGGRADSHQLAHL
FT                   GAIDVAVSAARWALASAAAEVDSDPLDRRSAQVRAFRVRGLVERTASEVIDRVGRALGA
FT                   APLASDADHASTVADLLVYIRQSHAERDLATLGELVAGED"
     MSTDVTHDST PTSAAVRAII RSGEAELPLP GDGSTAVRWG RLTEWCRRDL SIGRLLEAHA        60
     DADAILAEID GTRAGRNEWW GVWASEPPQP VLDAAHDSSG WRLRGTKAWC SGASMCTHAL       120
     ITARVDGRPR LFAVDLREPG VTPGRGGWRN PGMAATDTEA VTFDSVPARP VGSADRYLDR       180
     AGFWHGGIGV AACWFGGALA VAEPLRVRAR GGRADSHQLA HLGAIDVAVS AARWALASAA       240
     AEVDSDPLDR RSAQVRAFRV RGLVERTASE VIDRVGRALG AAPLASDADH ASTVADLLVY       300
     IRQSHAERDL ATLGELVAGE D                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page