(data stored in ACNUC7421 zone)

EMBL: AP011115.PE254

AP011115.PE254       Location/Qualifiers
FT   CDS             complement(218577..218966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48501"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR24"
FT                   /protein_id="BAH48501.1"
FT                   /translation="MTTDGMTRWQGIAQKCELMIQRCLNCTTLLAPLMATCSACQGSNL
FT                   ERVPSCGVGSIVSSKVVDRGLSGLDRGRVPCTIAIVELDEGPWVYTWIDGDVPAPSDCP
FT                   VRVEFRPASTAEQLPVFAVRAGDQR"
     MTTDGMTRWQ GIAQKCELMI QRCLNCTTLL APLMATCSAC QGSNLERVPS CGVGSIVSSK        60
     VVDRGLSGLD RGRVPCTIAI VELDEGPWVY TWIDGDVPAP SDCPVRVEFR PASTAEQLPV       120
     FAVRAGDQR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page