(data stored in ACNUC7421 zone)

EMBL: AP011115.PE256

AP011115.PE256       Location/Qualifiers
FT   CDS             complement(221697..222383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48503"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR26"
FT                   /protein_id="BAH48503.1"
FT                   /translation="MHPSTRTAVVTGSDSPMGRAVALALADDGFDVGLAYVADRDSAEA
FT                   TAADVESRSVRAAVQHMDLADLPGSADAVDEFARDLGGIGVLVSCPGSTAVECIQRAVR
FT                   YMIAGGGGGRVVNVTTSSSGLGGLTGLLAAELARYSITVNSVVVPAVEPDFAAPGPGDR
FT                   EVAAVASYLCAPAGMFVTGAAYVVDGARIAMIPHSLTEAGALRPPRRAGRIRSYTGRWA
FT                   PTRWTR"
     MHPSTRTAVV TGSDSPMGRA VALALADDGF DVGLAYVADR DSAEATAADV ESRSVRAAVQ        60
     HMDLADLPGS ADAVDEFARD LGGIGVLVSC PGSTAVECIQ RAVRYMIAGG GGGRVVNVTT       120
     SSSGLGGLTG LLAAELARYS ITVNSVVVPA VEPDFAAPGP GDREVAAVAS YLCAPAGMFV       180
     TGAAYVVDGA RIAMIPHSLT EAGALRPPRR AGRIRSYTGR WAPTRWTR                    228
//

If you have problems or comments...

PBIL Back to PBIL home page