(data stored in ACNUC7421 zone)

EMBL: AP011115.PE258

AP011115.PE258       Location/Qualifiers
FT   CDS             complement(223844..250627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02580"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48505"
FT                   /db_xref="GOA:C1AR28"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR28"
FT                   /protein_id="BAH48505.1"
FT                   /translation="MTSVNSPQPNDGAGDVNVPEGAFPLSSVQRSMWFAQQLSPTVPKF
FT                   IAQYIELRGEIDLDLLSDAAVRAGQEFQSPFLRLLDVDGEPYQAVDFSIDPSIGFLDFR
FT                   GESDPMDAARRWIDEDYATPLRLTRDRLVQMNVLQVGEQHYLWYTRIHHVALDGYSGMT
FT                   MVNRIAALYTAAIEGTEPEPNRALDLRELYELDQKYRKSSRFENDRLYWAERIVGIEHG
FT                   STLATHDAPAAAQSRLESARISESALGFLGESDQRVGATSAAVLLAGFACYLSRMTGKR
FT                   DVLINLPVSARTTAPLQRSGGMLVNVAPLRITVRPEDTVAELVQRTQLELMGALRHQRC
FT                   SLEDIRRDAGLAGTAEGLAGPMVNVMLFHQAFTLGTVSGEYHIVTSGPVDDLLVNIYQG
FT                   GDGETLLDFRGNPNRYGSEELRAHHRRFVELIEEFVAAEPQARTADIHAESARLGARFL
FT                   EQESQLAFWKRELAGLPEVTGLPLDRPRPAERAGAGEVVGFAVDAEVRHRAALLAEEAG
FT                   TGIFTTLHAALAVLLGRLGDTDDVVVGTPIVGRDTTDSEDPEAGAFFNKAVLRSQVDGA
FT                   SSFTDHLSRVRDADRAAFSHAALPFDDLVAAVVADPDPSHTPLFQVMLEFTDGGHPHDS
FT                   SGTVTVSPIQREHRALGLDLVFSLTESENGGINGRLRFATDVWDRDSAEALAARFVRIL
FT                   HAVTADPAAPIGDVDLLEPAEYAELAPVRDEPAVEPRTLPGLLAGAVTAGGDGDALVYE
FT                   GRTLTYPELDELSNRLARMLIGRGVGPGSVVALAIARSIESVLATWAVAKSGAAFVPVD
FT                   PNYPADRIEHMLTDSGAVVGLTATAHRSSLPTITPWLVMDDPSFSRELEQHTAGAVTDA
FT                   DRLRPLRTADPAYLIYTSGSTGTPKGVVVTHVGLANFAEDERQRFDVTAEARTLHFSSP
FT                   SFDASILELLLAVGAGATMVVAPSTVYGGTELADLLRRERVTHAFVTPAALASVDPTGL
FT                   DHIRCVVTGGESCPPALVQQWAPGRVMFNAYGPTEATVVASVAGPLTVGEPVTIGRPSR
FT                   GCGLLVLDSRLHPVPAGVPGELYITGDGVARGYHDRSVPTAERFVADPHGTPGERMYRT
FT                   GDLARWNAAGQLEYLGRTDFQVKIRGFRIELGEIDAVVRSHPSVAFATTVGRTAPSGDT
FT                   ALVTYVLPEDGAQIAVGDILEHAAAALPAHMVPARVMELLEVPLTPAGKLDRKALPEPQ
FT                   FEATSTVYRAPVTPTEMQIAEVFATLLGVERIGVDDSFFDLGGDSLVATRVVSRVNSAL
FT                   GTEIGVLDLFEAPSVALLSARVDAAGPRTSARPVLAPRAGSGPVQVSLAQQRMWFINQL
FT                   DTASPAYNIPVGIRLRGTLDVNALRTAVSDVLTRHESLRTVFPNTPNGPIQVVLPAAEV
FT                   SPRLDVIEVAESELESRLIDDAATGFDVTVEPPIRAELYRTATDDHVLVFVVHHIAADG
FT                   LSMTPLTRDVMVAYHARAAGEAPQWAPLEVQYADFAVWQRELLGSPDDPTSLLSRQLAF
FT                   WARTLDGAPEVMDLPTDRPRPARQSMIGATADFTIPARIHTALLDIAAANDASLFMVVH
FT                   AALAVLLSRSSGSSDVSIGSPVSGRGERQLDDVVGMFVNTVVLRTTVDPDRNFPEILSH
FT                   TRSVDLEAFSNTDLPYERLVDELKPTRSEAHSPLFQVMLVLQGFANTRLELPGLDVEVE
FT                   ALETGAAKFDLQVILTEHIEDSGAPGAIDVQFSYASELFDPPTMTALAARFVTLLETVT
FT                   AGSDAKVGDLDLIGADETHRMLEQWIDTDVPVPDSATLVSLFESQVARTPDAVAVVFAE
FT                   EELLYAEFDARANRLARELLARGVGPESRVAVALRRSLELMIAIYAVEKTGAAYVPLDP
FT                   DHPASRIAYVIESAEPACVLTASRDRCEGVDSADAAVIEIDTLNLSQRPSTPITDAERG
FT                   GPIHPDSTAYVIYTSGSTGRPKGVAVSHRAIANRLLWMQDTYRMDHTDVVLQKTPVTFD
FT                   VSVWELFWPLEVGARLVLAAPDGHRDPTYLSHIIADHQVTTMHFVPSMLAVFTAGAEPD
FT                   LCGSLRQVFCSGEALPPATADSFREFGSAALHNLYGPTEAAVDVTFWECTEGDRASVPI
FT                   GAPVWNTQLYVLDSRLHPVPVGVHGELYLAGVQLARGYVGRSDLTSDRFVANPFGAPGQ
FT                   RMYRTGDVVRWRADGNIEYIGRRDFQVKLRGQRIELGEVEAAVLAHPSVAQAVVTVHRS
FT                   EATGESLVGYVIPVAGADIDTAVVRDAAAEALPAYMVPTRIIVLDRFPLGATGKLDRGA
FT                   LPEPEFLSPSAEFVTPRNPIEEILASIFADLLDAPRIGVYDSFFDLGGNSLVATRLVAR
FT                   VNAALGSRIGVREIFDAPTVAALATRIESEAGQGAERPPLVAGVRPAHLPVSLAQKRMW
FT                   FINQFDLDSPAYNIALAVRLTGDLDEDAMQDAVADVMDRHESLRTRFPMVEGEPLQVIL
FT                   PTEDVVPDLTPIDSTEGQLPEHISRLAGAGFDVTVSVPVRAALYRTDPGEHVLVIVVHH
FT                   ISADGFSMAPLARDVMTAYAARTGGQAPDWTPLPVQYADFALWQHRVLGNADDPDSLLA
FT                   AQLDYWTHTLAGLPELLALPTDHPRPTQQSMRGGIHSFSIDRQIHSRLITTAREHNSSV
FT                   FMAVHAALAVLLARLGDTDDVAVGTPIAGRGDAALDDMVGMFVNTLVLRTPVEPSGTFT
FT                   DLLSTVRDADLNAFHHADLPFERLVDAISPERATSHSPLFQVVLEFRNNERPRLELPGL
FT                   TVTGLDLATDISNFDLQLTLTEEFGVSGEPAGISVAFTYASSLFDASTIAGFADYLQRI
FT                   FDAVTSEPGMAVGDIDLMVASERAALTPVMDGPDAEPRTLPELLASAASVDPKAAALSY
FT                   EGSEVTYRELDERSNRLARLLIGRGIGPESVVALAMARSPESVLSLWAVAKTGAAFVPV
FT                   DPNYPTDRIVHMLSDSGAALALTVAEFRPTLPDCTPYVVVDAPGFGDQVSAHSAAVVTD
FT                   ADRTHPLALENPAYLIYTSGSTGTPKGVVVTHRGLANFATDERVRFGVTPRSRTLHFSS
FT                   PSFDASILELLLAVGSGATMVIAPASVIGGTELADVLREGRVTHAFITPAAMASVDPAG
FT                   LDQLECVATGGDVCPPELVAQWVTGGRRMFNAYGPTEATVVSSVTGPMLPGEGVTIGRP
FT                   PMGTGEMVLDSRLHPVPNGVTGELYVTGSGLARGYKDRAGTTAERFVANPYGGLGARMY
FT                   RTGDLARWNTDGQLEYLGRSDFQVKIRGFRIELGEIENALTRYPGVARSVVSAHRGSTG
FT                   ANRLVGYLVPTAGAELDPEAVLDFVGGFLAPYMVPSALIVLDQLPLTPAGKLDRRALPE
FT                   PDFGARVSTGRAPVSEMEEVLAGLFAEVLGLESAGVEDSFFALGGDSIMSIQLVARAKA
FT                   AGVVLTPRDVFEAKTVAGLAAVASWIGAADIVVLDELPGGGVGDMPTTPITKWLLERGG
FT                   EFNRMSQSALLTAPPNLRELEPLIGTFQAVLDRHDMLRAQLMVSADESHLAVRPIGAVE
FT                   AQDLIRRVAVSAAPGTPAFAATVIADLDAALDRLDPAAGVMMQVVWFDAGESGGRLLVV
FT                   AHHLVVDGVSWRILVPDLATAWAQISAGQEPALEQVGTSMRRWAHGLVDEAANRAGELD
FT                   LWQRILDCEDPLVGSRPLDPDVDVNATVGRVTVQLPAEVSEAVLTALPEAIHGSVNDGL
FT                   LTALAMAVTQWRRTRGHTLHGRSVDGTLVSLEGHGREDQVVPGADLGRTVGWFTAMFPV
FT                   RLDLSGIDLDDAFDGGRAAGSAIKAIKEQLLAIPDHGMGYGMLRYLNADTAPLLAARSL
FT                   PQISFNYLGRFAADLSEAATRAGWTPTGEVDMDRAQDLDTPVTSAIDVNAVTTEVDDRP
FT                   QLRATWAYAAGVLTVAEVRELAELWVRALTALTTYAARPDAGGVTPSDLELVSLDQDAI
FT                   DRIESRFPALSDIWSLSPLQSGLLFHALLADESIDSYTVQVTLELRGAVSSRLRVAGQA
FT                   LLDRHANLRASFVYDEGGTPVQAVHGYAELPWTEIDLSALDEDSREAEITELLDTDRRR
FT                   GFDMATPPLLRFMLIQVGADEQRLIITNHHILLDGWSMPLLIRDLLTLYATEGDATALP
FT                   RVHPYRDYLAWMSHRSTEDSLGVWHRALAGVEEPTLLAPADAAAKSDTQSSELIVELDV
FT                   DRTDQLSVLAREHGLTLSTLIRTAWGIVLGGLVGRSDVVFGGTVSGRPPQIAGIESMVG
FT                   LFINTLPVRVTLDPRETLGELLERIQGEQAALLDHHYVGLTDIQSVAGPGAGFDTLTVF
FT                   ESYPVDREGLTEQTDIAGMHVLDVHDSANAAHYPLALIASAHENLQLKLEYVEDLFDRA
FT                   AVERIGDRVVRALIALAEHPGMKLAQLRLLTDVEEAELVPARGKPGRSVRTLPQMFADT
FT                   AAASGDATALVFGDRRMSYRELDERSNQLARLLIGRGVGPEDIVALGISRSIESVLAVW
FT                   SITKTGAAFVPVDPTYPRERVEHMVTDSGCTFGVRVGADRDRLPAAVTWLTLDDAETDA
FT                   AVGAMSTDTVTDDERVVPLRFAHPAYVIYTSGSTGKPKGVVVSHRGLDNFAEEQRDRYA
FT                   TDSASRALHFSSPSFDASVLEYLLAFAVGATMVIVPPSVYGGEELAELIRAEGVTHGFV
FT                   TPAALASVDPEGLDVFQNVVAGGEAVPPELVTRWAPGRTLYNGYGPTETTIMSNLSDHL
FT                   QVGETVTIGGPVRGVSEVILDSRLQPVSVGVAGELYISGEGLARGYHARAGLTSERFVA
FT                   NPYGEAGDRMYRTGDLARWRSDHTVEYLGRTDFQVKIRGFRIELGDIDSALAGHPSVAF
FT                   AVTLGRPGPAGDTVLVSYVLPEAESVLEPPELKEWTANLLPAHMVPSSIMILDEIPLTP
FT                   VGKLDRAGLPEPQFLPTSDAFRPPSTVLEHTIADVVTTVLGIERVGIDDNFFDIGGNSL
FT                   IATRVAARLTAELDTDIGVRTLFEAPTIHQLARLIESTAFAPAQDGDHVRLPLGPMAQP
FT                   AHVPVSLAQKRMWFLNQFDTSSAAYNIPLAVRLTGHLDVESLRAAVTDVFVRHESLRTV
FT                   FPSHDGEPTQVVLSPGQWTPNLEITEVSEAELREHIAGLATAGFDVTADVPMRSALFAL
FT                   APDDHVLVIVVHHICADGFSLTPLARDVMTAYAARIAGSAPQWNPLSVQYADYTLWQLQ
FT                   LLGDESDSESLISQQLRYWTDQLADLPELLQLPTDRARPVQQSFRGAQVDFTIPADVHR
FT                   ALSALARKHNSTMFMAVHAALSVLLSALSSTEDIAVGTPIAGRGDAALDDMVGMFVNTL
FT                   VLRSAVDPAAGFGALIDQVRGTDLAAFHHSDLPFERLVDVLAPERSTAHSPLFQALLEF
FT                   RNNETPRLELPELTAAAVDFDLEVAKFDLQLSVEEGFDADGVASGITAAFIYATDLFDA
FT                   GTVRTFADRFLRILTAVTADPQAPVGDIVITDAAERSAMATVWNTAGVEAGTDTLADRF
FT                   AQSVARFPGATAVTSEDVALTYAELDARANRLARLLIAQGVGPETLVAVALPRTCDLII
FT                   ALLAVIKSGGGYLPVDITYPADRLAFVFEDAAPNCVITTTGDVSALPDSETPAILLDDP
FT                   ETTADLAQQSPATITDADRVTPLDAASVAYVIYTSGSTGRPKGVVVSHRNVLTLFANTQ
FT                   PLYGFDENDVWTMFHSYAFDFSVWELWGPLLYGGRLVVVDYYTARSPEMFHELLRNEQV
FT                   TVLNQTPTAFYQLAETDRIVSEIDVNAAALALRYVIFGGEALDLGQLGRWYSRHDDAAP
FT                   TLANMYGITETTVHVSYLALDRAFAESASASVIGRGIAGLHVHVLDRRLHPVPPGTIGE
FT                   MYVSGDQVTRGYLGRAGLSSTRFVADPLRPGARMYRTGDLARWNTDGQLEYLGRSDFQV
FT                   KIRGFRIELGEIESALLRYRGIAQAVVLTRDDGHGGHRLIGYVVPESGATVEVSSALEF
FT                   VGTQLTSYMVPATLVVLDALPLTSNGKLDRRALPEPDFGARVSAGRAPATEMETVLAGL
FT                   FAEVLGLESVGVDDSFFALGGDSIMSIQLVARAKAAGVVLTPRDVFEAKTVASLAEAAS
FT                   WAGAADVVVLDELPGGGIGEMPVTPITTWLLERGGDFRRYTQTALLSLPAAADETLLKR
FT                   TIAAVVDHHDMLRARLVGAAPQWRIEVQATGAVDVDDVLHRVEVPSVVGSAFADVATRE
FT                   LDSAAERLDPEAGVMLQMVWFDAGTEGGRLLVVAHHLVVDGVSWRILVPDLATAWAQVS
FT                   AGQEPALEPVGTSMRRWSHGLVDATRERGAEIELWRRVLEADDPLIGSRPLDPAIDVAG
FT                   TVEKVTVEVPADVTDALLTRVPEAFHGGVNDGLLTALALALAQWRRGRGDLTRESLVSL
FT                   EGHGREDQVLPGADLGRTVGWFTAMFPVRLDLSGIDLDDAFAGGRGAGSAIKAIKEQLL
FT                   AIPDHGIGYGMLRYLGQDSADQLRALAKPQVTFNYLGRLGGATSTDVHGHAWVPVTDTK
FT                   LDDIPASDIPVASALDINAVTGTGPDGNRLRATWAFPTGVLTPSEVRALADLWVQALTA
FT                   LTTHVARPDAGGVTPSDLDLVTLDQDAIDRLEARFPALSDIWSLSPLQSGLLFHAQFSD
FT                   ATVDPYLVQLALKLRGDVNPDRFRRAGQALLDRHPNLRAAFVHDSAGASAQIIQQHVEL
FT                   PWSEFDLSALGPEETTREYERIVARDRSVKFDMADAPLLRLALVRLTDDEYRLILTNHH
FT                   ILLDGWSTPLVLRDLLTLYALDADGSLLPRVHSYRDYLTWMKRHDTTDSLDAWRAALDG
FT                   VEEPTLLAPLERGEAHSAVAEETAFTLSEEHTTRLRDLSRERGLTLNTVVQTAWGIVLG
FT                   GLVGRSDVVFGGTVSGRPPQISGIESMVGLFINTLPVRVTLDPWESLGELLERVQREQA
FT                   TLLDHHYVGLTDIQSAVGGGGTFDTLTVFESYPVDEAGLTEQTDIAGMFVLGIDGKDSA
FT                   HYPLAVVASGDARLNFKFEYLPDVLEESAVDEIADRLRRVLDALADRPEIPLAHMQLLT
FT                   EAELAEFAPVRGRPGFSVRTLPQIFEDAAALDPNRTALTFEGRNVSYRELNERSNQLAR
FT                   VLISRGAGPETFVALGIPRSIESVLAVWAVAKTGAAFVPVDPNYPMDRIEHMLTDSGAT
FT                   IGLTMAAYEKSLPDSVPWLQLDSPKFEKACQAKPALPVADSDRRSPISLDNAAYIVYTS
FT                   GSTGKPKGVVVTHEGLDNFAEDQRQRFAAAQTSRTLHFSTPSFDGSVFEYLQAFGVGAT
FT                   MVIAPPTVYGGAELAELIRSEHVTHAFVTTAALSTVDPEGLDEFQHVVFGGEACPPELV
FT                   TRWAPGRQLSNAYGPTETTVMANISDPMTVGEPITLGGPIRGVGELVLDSRLQPVPVGV
FT                   PGELYITGAGLARGYHRRPELSSQRFVANPFGEAGERMYRTGDIVRWRADHTVEYVGRS
FT                   DFQVKIRGFRIELGEIDNEIATFPGVGFAATLGAPGPSGDTVLVTYLLPVTEGGVDPAE
FT                   LTAHLSTRLPAHMVPTSIMFLDEIPLTPVGKLDRSALPAPEFHVTTTEFQPPTNDLERK
FT                   IVDIFTDVLGLERIGIDDNFFDLGGNSLVATRVTARLRDALDTDIGVRALFEAPDARSL
FT                   AERVADSVSGGARPALAPVERPDRIPLSLAQKRMWFLNQFDTSSPAYNIPLAVRLTGTL
FT                   DEDALRLAMADVLDRHETLRTVFPTVDNEPTQRILAAADAQPGVDTVPVDAADLPRHIM
FT                   DLVSRGFDVSTDVPVRAALFRTAPDHHVLTIVVHHICADGFSLAPLARDVMVAYTSRLA
FT                   GAGPQWAPLHVQYADYTLWQHAGLGSENDPESMINRQLRFWSEALAGLPDVIQLPTDRP
FT                   RPIQQTFEGDRVEFAIDADLHQRLTALARANNATMFMAVHAALAVLLSRLGSTDDVVIG
FT                   TPVAGRGEEALDEMVGMFVNTLVLRNRIDPSATFTELVQQIRESDLAAFAHADLPFERL
FT                   VEELNPTRSTSYSPLFQVALEFQNNENPTLELPDLRVENVDLETRVVKEDLEVILAERF
FT                   DQDGAPAGVAGGLDFAVSLFDPDTARSIADRFVRILAAVVADPDRPIGTVPMLDDAEID
FT                   EMVPARGKPDVRPEVWPDLLTAAAALDPDSVALSFEDRQVTYRELDEWSNRLARVLCAQ
FT                   GAGPETFVAIGMPRSIEEVVSIWSVAKSGAAFVPVDPTYPRDRIDYMLTDCRASIGLTV
FT                   AGRRDNLPDTVPWLVLDDHAFAKQVADVSSAPVTDADRTAPLHLAHPAYLIYTSGSTGK
FT                   PKGVIVTHRGMANLTAEEHERFQVTHDSRVSHLASPSFDASIFELMMAFGASARVVIVP
FT                   PTVFGGAELADLFRRNEVTHAFITPTALSSIEDVGLESLRVLAVAGEACPPELVEIWGK
FT                   HRNMHNGYGPTETTIQASVSAPMRPGGVVNIGAPALGFGSLVLDERLQPVPAGVPGELY
FT                   ITGPGLARGYHNRSALTSERFVACPYGEPGRRMYRTGDVVRWRGDHTIEYIGRTDFQVK
FT                   VRGFRIELGEIDAVLARHPAVAFAATIGHTGPSGDTLLASYVRAAEGHDLEPAELRTHA
FT                   SDRLPAHMVPSAVVVLDQIPMTPVGKLDRKALPAPEFGTTGAAFRAPTTATERIIVEAF
FT                   AEVLGVDRVGTADSFFDLGGNSIVATRVITVLQDRLGRQIPLQSMFLDPTPAGLALRVD
FT                   TENAAGSPVDEALGVVIPLRPTGDKAPLFCIHPGIGLSWGYAGLLQHLSPDRPAFGLQL
FT                   PIISGGTAVDSIEQLAHRYVLEMRKVQAHGPYHLLGWSLGGVIAHAMAVELRREGEAVD
FT                   TLALMDSYVANGTEQGPETLTVAELLHGLGLDLESVSGEELTYERAVELLDDAFGQKTG
FT                   LTPRHLERISAGFTNSSRIMNNFRPQVFDGDLLFFTAAGSASTGEHSPEEWRDSVTGGI
FT                   REVKIECEHNQMIEPEVLAVVGPVLEDYLGTH"
     MTSVNSPQPN DGAGDVNVPE GAFPLSSVQR SMWFAQQLSP TVPKFIAQYI ELRGEIDLDL        60
     LSDAAVRAGQ EFQSPFLRLL DVDGEPYQAV DFSIDPSIGF LDFRGESDPM DAARRWIDED       120
     YATPLRLTRD RLVQMNVLQV GEQHYLWYTR IHHVALDGYS GMTMVNRIAA LYTAAIEGTE       180
     PEPNRALDLR ELYELDQKYR KSSRFENDRL YWAERIVGIE HGSTLATHDA PAAAQSRLES       240
     ARISESALGF LGESDQRVGA TSAAVLLAGF ACYLSRMTGK RDVLINLPVS ARTTAPLQRS       300
     GGMLVNVAPL RITVRPEDTV AELVQRTQLE LMGALRHQRC SLEDIRRDAG LAGTAEGLAG       360
     PMVNVMLFHQ AFTLGTVSGE YHIVTSGPVD DLLVNIYQGG DGETLLDFRG NPNRYGSEEL       420
     RAHHRRFVEL IEEFVAAEPQ ARTADIHAES ARLGARFLEQ ESQLAFWKRE LAGLPEVTGL       480
     PLDRPRPAER AGAGEVVGFA VDAEVRHRAA LLAEEAGTGI FTTLHAALAV LLGRLGDTDD       540
     VVVGTPIVGR DTTDSEDPEA GAFFNKAVLR SQVDGASSFT DHLSRVRDAD RAAFSHAALP       600
     FDDLVAAVVA DPDPSHTPLF QVMLEFTDGG HPHDSSGTVT VSPIQREHRA LGLDLVFSLT       660
     ESENGGINGR LRFATDVWDR DSAEALAARF VRILHAVTAD PAAPIGDVDL LEPAEYAELA       720
     PVRDEPAVEP RTLPGLLAGA VTAGGDGDAL VYEGRTLTYP ELDELSNRLA RMLIGRGVGP       780
     GSVVALAIAR SIESVLATWA VAKSGAAFVP VDPNYPADRI EHMLTDSGAV VGLTATAHRS       840
     SLPTITPWLV MDDPSFSREL EQHTAGAVTD ADRLRPLRTA DPAYLIYTSG STGTPKGVVV       900
     THVGLANFAE DERQRFDVTA EARTLHFSSP SFDASILELL LAVGAGATMV VAPSTVYGGT       960
     ELADLLRRER VTHAFVTPAA LASVDPTGLD HIRCVVTGGE SCPPALVQQW APGRVMFNAY      1020
     GPTEATVVAS VAGPLTVGEP VTIGRPSRGC GLLVLDSRLH PVPAGVPGEL YITGDGVARG      1080
     YHDRSVPTAE RFVADPHGTP GERMYRTGDL ARWNAAGQLE YLGRTDFQVK IRGFRIELGE      1140
     IDAVVRSHPS VAFATTVGRT APSGDTALVT YVLPEDGAQI AVGDILEHAA AALPAHMVPA      1200
     RVMELLEVPL TPAGKLDRKA LPEPQFEATS TVYRAPVTPT EMQIAEVFAT LLGVERIGVD      1260
     DSFFDLGGDS LVATRVVSRV NSALGTEIGV LDLFEAPSVA LLSARVDAAG PRTSARPVLA      1320
     PRAGSGPVQV SLAQQRMWFI NQLDTASPAY NIPVGIRLRG TLDVNALRTA VSDVLTRHES      1380
     LRTVFPNTPN GPIQVVLPAA EVSPRLDVIE VAESELESRL IDDAATGFDV TVEPPIRAEL      1440
     YRTATDDHVL VFVVHHIAAD GLSMTPLTRD VMVAYHARAA GEAPQWAPLE VQYADFAVWQ      1500
     RELLGSPDDP TSLLSRQLAF WARTLDGAPE VMDLPTDRPR PARQSMIGAT ADFTIPARIH      1560
     TALLDIAAAN DASLFMVVHA ALAVLLSRSS GSSDVSIGSP VSGRGERQLD DVVGMFVNTV      1620
     VLRTTVDPDR NFPEILSHTR SVDLEAFSNT DLPYERLVDE LKPTRSEAHS PLFQVMLVLQ      1680
     GFANTRLELP GLDVEVEALE TGAAKFDLQV ILTEHIEDSG APGAIDVQFS YASELFDPPT      1740
     MTALAARFVT LLETVTAGSD AKVGDLDLIG ADETHRMLEQ WIDTDVPVPD SATLVSLFES      1800
     QVARTPDAVA VVFAEEELLY AEFDARANRL ARELLARGVG PESRVAVALR RSLELMIAIY      1860
     AVEKTGAAYV PLDPDHPASR IAYVIESAEP ACVLTASRDR CEGVDSADAA VIEIDTLNLS      1920
     QRPSTPITDA ERGGPIHPDS TAYVIYTSGS TGRPKGVAVS HRAIANRLLW MQDTYRMDHT      1980
     DVVLQKTPVT FDVSVWELFW PLEVGARLVL AAPDGHRDPT YLSHIIADHQ VTTMHFVPSM      2040
     LAVFTAGAEP DLCGSLRQVF CSGEALPPAT ADSFREFGSA ALHNLYGPTE AAVDVTFWEC      2100
     TEGDRASVPI GAPVWNTQLY VLDSRLHPVP VGVHGELYLA GVQLARGYVG RSDLTSDRFV      2160
     ANPFGAPGQR MYRTGDVVRW RADGNIEYIG RRDFQVKLRG QRIELGEVEA AVLAHPSVAQ      2220
     AVVTVHRSEA TGESLVGYVI PVAGADIDTA VVRDAAAEAL PAYMVPTRII VLDRFPLGAT      2280
     GKLDRGALPE PEFLSPSAEF VTPRNPIEEI LASIFADLLD APRIGVYDSF FDLGGNSLVA      2340
     TRLVARVNAA LGSRIGVREI FDAPTVAALA TRIESEAGQG AERPPLVAGV RPAHLPVSLA      2400
     QKRMWFINQF DLDSPAYNIA LAVRLTGDLD EDAMQDAVAD VMDRHESLRT RFPMVEGEPL      2460
     QVILPTEDVV PDLTPIDSTE GQLPEHISRL AGAGFDVTVS VPVRAALYRT DPGEHVLVIV      2520
     VHHISADGFS MAPLARDVMT AYAARTGGQA PDWTPLPVQY ADFALWQHRV LGNADDPDSL      2580
     LAAQLDYWTH TLAGLPELLA LPTDHPRPTQ QSMRGGIHSF SIDRQIHSRL ITTAREHNSS      2640
     VFMAVHAALA VLLARLGDTD DVAVGTPIAG RGDAALDDMV GMFVNTLVLR TPVEPSGTFT      2700
     DLLSTVRDAD LNAFHHADLP FERLVDAISP ERATSHSPLF QVVLEFRNNE RPRLELPGLT      2760
     VTGLDLATDI SNFDLQLTLT EEFGVSGEPA GISVAFTYAS SLFDASTIAG FADYLQRIFD      2820
     AVTSEPGMAV GDIDLMVASE RAALTPVMDG PDAEPRTLPE LLASAASVDP KAAALSYEGS      2880
     EVTYRELDER SNRLARLLIG RGIGPESVVA LAMARSPESV LSLWAVAKTG AAFVPVDPNY      2940
     PTDRIVHMLS DSGAALALTV AEFRPTLPDC TPYVVVDAPG FGDQVSAHSA AVVTDADRTH      3000
     PLALENPAYL IYTSGSTGTP KGVVVTHRGL ANFATDERVR FGVTPRSRTL HFSSPSFDAS      3060
     ILELLLAVGS GATMVIAPAS VIGGTELADV LREGRVTHAF ITPAAMASVD PAGLDQLECV      3120
     ATGGDVCPPE LVAQWVTGGR RMFNAYGPTE ATVVSSVTGP MLPGEGVTIG RPPMGTGEMV      3180
     LDSRLHPVPN GVTGELYVTG SGLARGYKDR AGTTAERFVA NPYGGLGARM YRTGDLARWN      3240
     TDGQLEYLGR SDFQVKIRGF RIELGEIENA LTRYPGVARS VVSAHRGSTG ANRLVGYLVP      3300
     TAGAELDPEA VLDFVGGFLA PYMVPSALIV LDQLPLTPAG KLDRRALPEP DFGARVSTGR      3360
     APVSEMEEVL AGLFAEVLGL ESAGVEDSFF ALGGDSIMSI QLVARAKAAG VVLTPRDVFE      3420
     AKTVAGLAAV ASWIGAADIV VLDELPGGGV GDMPTTPITK WLLERGGEFN RMSQSALLTA      3480
     PPNLRELEPL IGTFQAVLDR HDMLRAQLMV SADESHLAVR PIGAVEAQDL IRRVAVSAAP      3540
     GTPAFAATVI ADLDAALDRL DPAAGVMMQV VWFDAGESGG RLLVVAHHLV VDGVSWRILV      3600
     PDLATAWAQI SAGQEPALEQ VGTSMRRWAH GLVDEAANRA GELDLWQRIL DCEDPLVGSR      3660
     PLDPDVDVNA TVGRVTVQLP AEVSEAVLTA LPEAIHGSVN DGLLTALAMA VTQWRRTRGH      3720
     TLHGRSVDGT LVSLEGHGRE DQVVPGADLG RTVGWFTAMF PVRLDLSGID LDDAFDGGRA      3780
     AGSAIKAIKE QLLAIPDHGM GYGMLRYLNA DTAPLLAARS LPQISFNYLG RFAADLSEAA      3840
     TRAGWTPTGE VDMDRAQDLD TPVTSAIDVN AVTTEVDDRP QLRATWAYAA GVLTVAEVRE      3900
     LAELWVRALT ALTTYAARPD AGGVTPSDLE LVSLDQDAID RIESRFPALS DIWSLSPLQS      3960
     GLLFHALLAD ESIDSYTVQV TLELRGAVSS RLRVAGQALL DRHANLRASF VYDEGGTPVQ      4020
     AVHGYAELPW TEIDLSALDE DSREAEITEL LDTDRRRGFD MATPPLLRFM LIQVGADEQR      4080
     LIITNHHILL DGWSMPLLIR DLLTLYATEG DATALPRVHP YRDYLAWMSH RSTEDSLGVW      4140
     HRALAGVEEP TLLAPADAAA KSDTQSSELI VELDVDRTDQ LSVLAREHGL TLSTLIRTAW      4200
     GIVLGGLVGR SDVVFGGTVS GRPPQIAGIE SMVGLFINTL PVRVTLDPRE TLGELLERIQ      4260
     GEQAALLDHH YVGLTDIQSV AGPGAGFDTL TVFESYPVDR EGLTEQTDIA GMHVLDVHDS      4320
     ANAAHYPLAL IASAHENLQL KLEYVEDLFD RAAVERIGDR VVRALIALAE HPGMKLAQLR      4380
     LLTDVEEAEL VPARGKPGRS VRTLPQMFAD TAAASGDATA LVFGDRRMSY RELDERSNQL      4440
     ARLLIGRGVG PEDIVALGIS RSIESVLAVW SITKTGAAFV PVDPTYPRER VEHMVTDSGC      4500
     TFGVRVGADR DRLPAAVTWL TLDDAETDAA VGAMSTDTVT DDERVVPLRF AHPAYVIYTS      4560
     GSTGKPKGVV VSHRGLDNFA EEQRDRYATD SASRALHFSS PSFDASVLEY LLAFAVGATM      4620
     VIVPPSVYGG EELAELIRAE GVTHGFVTPA ALASVDPEGL DVFQNVVAGG EAVPPELVTR      4680
     WAPGRTLYNG YGPTETTIMS NLSDHLQVGE TVTIGGPVRG VSEVILDSRL QPVSVGVAGE      4740
     LYISGEGLAR GYHARAGLTS ERFVANPYGE AGDRMYRTGD LARWRSDHTV EYLGRTDFQV      4800
     KIRGFRIELG DIDSALAGHP SVAFAVTLGR PGPAGDTVLV SYVLPEAESV LEPPELKEWT      4860
     ANLLPAHMVP SSIMILDEIP LTPVGKLDRA GLPEPQFLPT SDAFRPPSTV LEHTIADVVT      4920
     TVLGIERVGI DDNFFDIGGN SLIATRVAAR LTAELDTDIG VRTLFEAPTI HQLARLIEST      4980
     AFAPAQDGDH VRLPLGPMAQ PAHVPVSLAQ KRMWFLNQFD TSSAAYNIPL AVRLTGHLDV      5040
     ESLRAAVTDV FVRHESLRTV FPSHDGEPTQ VVLSPGQWTP NLEITEVSEA ELREHIAGLA      5100
     TAGFDVTADV PMRSALFALA PDDHVLVIVV HHICADGFSL TPLARDVMTA YAARIAGSAP      5160
     QWNPLSVQYA DYTLWQLQLL GDESDSESLI SQQLRYWTDQ LADLPELLQL PTDRARPVQQ      5220
     SFRGAQVDFT IPADVHRALS ALARKHNSTM FMAVHAALSV LLSALSSTED IAVGTPIAGR      5280
     GDAALDDMVG MFVNTLVLRS AVDPAAGFGA LIDQVRGTDL AAFHHSDLPF ERLVDVLAPE      5340
     RSTAHSPLFQ ALLEFRNNET PRLELPELTA AAVDFDLEVA KFDLQLSVEE GFDADGVASG      5400
     ITAAFIYATD LFDAGTVRTF ADRFLRILTA VTADPQAPVG DIVITDAAER SAMATVWNTA      5460
     GVEAGTDTLA DRFAQSVARF PGATAVTSED VALTYAELDA RANRLARLLI AQGVGPETLV      5520
     AVALPRTCDL IIALLAVIKS GGGYLPVDIT YPADRLAFVF EDAAPNCVIT TTGDVSALPD      5580
     SETPAILLDD PETTADLAQQ SPATITDADR VTPLDAASVA YVIYTSGSTG RPKGVVVSHR      5640
     NVLTLFANTQ PLYGFDENDV WTMFHSYAFD FSVWELWGPL LYGGRLVVVD YYTARSPEMF      5700
     HELLRNEQVT VLNQTPTAFY QLAETDRIVS EIDVNAAALA LRYVIFGGEA LDLGQLGRWY      5760
     SRHDDAAPTL ANMYGITETT VHVSYLALDR AFAESASASV IGRGIAGLHV HVLDRRLHPV      5820
     PPGTIGEMYV SGDQVTRGYL GRAGLSSTRF VADPLRPGAR MYRTGDLARW NTDGQLEYLG      5880
     RSDFQVKIRG FRIELGEIES ALLRYRGIAQ AVVLTRDDGH GGHRLIGYVV PESGATVEVS      5940
     SALEFVGTQL TSYMVPATLV VLDALPLTSN GKLDRRALPE PDFGARVSAG RAPATEMETV      6000
     LAGLFAEVLG LESVGVDDSF FALGGDSIMS IQLVARAKAA GVVLTPRDVF EAKTVASLAE      6060
     AASWAGAADV VVLDELPGGG IGEMPVTPIT TWLLERGGDF RRYTQTALLS LPAAADETLL      6120
     KRTIAAVVDH HDMLRARLVG AAPQWRIEVQ ATGAVDVDDV LHRVEVPSVV GSAFADVATR      6180
     ELDSAAERLD PEAGVMLQMV WFDAGTEGGR LLVVAHHLVV DGVSWRILVP DLATAWAQVS      6240
     AGQEPALEPV GTSMRRWSHG LVDATRERGA EIELWRRVLE ADDPLIGSRP LDPAIDVAGT      6300
     VEKVTVEVPA DVTDALLTRV PEAFHGGVND GLLTALALAL AQWRRGRGDL TRESLVSLEG      6360
     HGREDQVLPG ADLGRTVGWF TAMFPVRLDL SGIDLDDAFA GGRGAGSAIK AIKEQLLAIP      6420
     DHGIGYGMLR YLGQDSADQL RALAKPQVTF NYLGRLGGAT STDVHGHAWV PVTDTKLDDI      6480
     PASDIPVASA LDINAVTGTG PDGNRLRATW AFPTGVLTPS EVRALADLWV QALTALTTHV      6540
     ARPDAGGVTP SDLDLVTLDQ DAIDRLEARF PALSDIWSLS PLQSGLLFHA QFSDATVDPY      6600
     LVQLALKLRG DVNPDRFRRA GQALLDRHPN LRAAFVHDSA GASAQIIQQH VELPWSEFDL      6660
     SALGPEETTR EYERIVARDR SVKFDMADAP LLRLALVRLT DDEYRLILTN HHILLDGWST      6720
     PLVLRDLLTL YALDADGSLL PRVHSYRDYL TWMKRHDTTD SLDAWRAALD GVEEPTLLAP      6780
     LERGEAHSAV AEETAFTLSE EHTTRLRDLS RERGLTLNTV VQTAWGIVLG GLVGRSDVVF      6840
     GGTVSGRPPQ ISGIESMVGL FINTLPVRVT LDPWESLGEL LERVQREQAT LLDHHYVGLT      6900
     DIQSAVGGGG TFDTLTVFES YPVDEAGLTE QTDIAGMFVL GIDGKDSAHY PLAVVASGDA      6960
     RLNFKFEYLP DVLEESAVDE IADRLRRVLD ALADRPEIPL AHMQLLTEAE LAEFAPVRGR      7020
     PGFSVRTLPQ IFEDAAALDP NRTALTFEGR NVSYRELNER SNQLARVLIS RGAGPETFVA      7080
     LGIPRSIESV LAVWAVAKTG AAFVPVDPNY PMDRIEHMLT DSGATIGLTM AAYEKSLPDS      7140
     VPWLQLDSPK FEKACQAKPA LPVADSDRRS PISLDNAAYI VYTSGSTGKP KGVVVTHEGL      7200
     DNFAEDQRQR FAAAQTSRTL HFSTPSFDGS VFEYLQAFGV GATMVIAPPT VYGGAELAEL      7260
     IRSEHVTHAF VTTAALSTVD PEGLDEFQHV VFGGEACPPE LVTRWAPGRQ LSNAYGPTET      7320
     TVMANISDPM TVGEPITLGG PIRGVGELVL DSRLQPVPVG VPGELYITGA GLARGYHRRP      7380
     ELSSQRFVAN PFGEAGERMY RTGDIVRWRA DHTVEYVGRS DFQVKIRGFR IELGEIDNEI      7440
     ATFPGVGFAA TLGAPGPSGD TVLVTYLLPV TEGGVDPAEL TAHLSTRLPA HMVPTSIMFL      7500
     DEIPLTPVGK LDRSALPAPE FHVTTTEFQP PTNDLERKIV DIFTDVLGLE RIGIDDNFFD      7560
     LGGNSLVATR VTARLRDALD TDIGVRALFE APDARSLAER VADSVSGGAR PALAPVERPD      7620
     RIPLSLAQKR MWFLNQFDTS SPAYNIPLAV RLTGTLDEDA LRLAMADVLD RHETLRTVFP      7680
     TVDNEPTQRI LAAADAQPGV DTVPVDAADL PRHIMDLVSR GFDVSTDVPV RAALFRTAPD      7740
     HHVLTIVVHH ICADGFSLAP LARDVMVAYT SRLAGAGPQW APLHVQYADY TLWQHAGLGS      7800
     ENDPESMINR QLRFWSEALA GLPDVIQLPT DRPRPIQQTF EGDRVEFAID ADLHQRLTAL      7860
     ARANNATMFM AVHAALAVLL SRLGSTDDVV IGTPVAGRGE EALDEMVGMF VNTLVLRNRI      7920
     DPSATFTELV QQIRESDLAA FAHADLPFER LVEELNPTRS TSYSPLFQVA LEFQNNENPT      7980
     LELPDLRVEN VDLETRVVKE DLEVILAERF DQDGAPAGVA GGLDFAVSLF DPDTARSIAD      8040
     RFVRILAAVV ADPDRPIGTV PMLDDAEIDE MVPARGKPDV RPEVWPDLLT AAAALDPDSV      8100
     ALSFEDRQVT YRELDEWSNR LARVLCAQGA GPETFVAIGM PRSIEEVVSI WSVAKSGAAF      8160
     VPVDPTYPRD RIDYMLTDCR ASIGLTVAGR RDNLPDTVPW LVLDDHAFAK QVADVSSAPV      8220
     TDADRTAPLH LAHPAYLIYT SGSTGKPKGV IVTHRGMANL TAEEHERFQV THDSRVSHLA      8280
     SPSFDASIFE LMMAFGASAR VVIVPPTVFG GAELADLFRR NEVTHAFITP TALSSIEDVG      8340
     LESLRVLAVA GEACPPELVE IWGKHRNMHN GYGPTETTIQ ASVSAPMRPG GVVNIGAPAL      8400
     GFGSLVLDER LQPVPAGVPG ELYITGPGLA RGYHNRSALT SERFVACPYG EPGRRMYRTG      8460
     DVVRWRGDHT IEYIGRTDFQ VKVRGFRIEL GEIDAVLARH PAVAFAATIG HTGPSGDTLL      8520
     ASYVRAAEGH DLEPAELRTH ASDRLPAHMV PSAVVVLDQI PMTPVGKLDR KALPAPEFGT      8580
     TGAAFRAPTT ATERIIVEAF AEVLGVDRVG TADSFFDLGG NSIVATRVIT VLQDRLGRQI      8640
     PLQSMFLDPT PAGLALRVDT ENAAGSPVDE ALGVVIPLRP TGDKAPLFCI HPGIGLSWGY      8700
     AGLLQHLSPD RPAFGLQLPI ISGGTAVDSI EQLAHRYVLE MRKVQAHGPY HLLGWSLGGV      8760
     IAHAMAVELR REGEAVDTLA LMDSYVANGT EQGPETLTVA ELLHGLGLDL ESVSGEELTY      8820
     ERAVELLDDA FGQKTGLTPR HLERISAGFT NSSRIMNNFR PQVFDGDLLF FTAAGSASTG      8880
     EHSPEEWRDS VTGGIREVKI ECEHNQMIEP EVLAVVGPVL EDYLGTH                    8927
//

If you have problems or comments...

PBIL Back to PBIL home page