(data stored in ACNUC7421 zone)

EMBL: AP011115.PE26

AP011115.PE26        Location/Qualifiers
FT   CDS             22815..23573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00260"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48273"
FT                   /db_xref="GOA:C1AS24"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS24"
FT                   /protein_id="BAH48273.1"
FT                   /translation="MSTGASIGVLGGMIGLGGAEFRLPVLIGLFGFVALQAVIVNKAMS
FT                   LIVVLTALPARLMSVPYADLVPHWSVVVNLLCGSLVGAWVGATWATKMRSATLYKVLAV
FT                   LLVVIAIALGASHFGELGTLDLGPLSRTIAGLIAGFGIGVVAALMGVAGGELLIPTIVL
FT                   LYGVDIKIAGSLSLAVSLPTMLVAFARYSRDRSFGVLKANGRFVIAMSLGSIIGTVIGG
FT                   LLLGVVPETVLIPLLMLLLLASAVKVWRHH"
     MSTGASIGVL GGMIGLGGAE FRLPVLIGLF GFVALQAVIV NKAMSLIVVL TALPARLMSV        60
     PYADLVPHWS VVVNLLCGSL VGAWVGATWA TKMRSATLYK VLAVLLVVIA IALGASHFGE       120
     LGTLDLGPLS RTIAGLIAGF GIGVVAALMG VAGGELLIPT IVLLYGVDIK IAGSLSLAVS       180
     LPTMLVAFAR YSRDRSFGVL KANGRFVIAM SLGSIIGTVI GGLLLGVVPE TVLIPLLMLL       240
     LLASAVKVWR HH                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page