(data stored in ACNUC7421 zone)

EMBL: AP011115.PE260

AP011115.PE260       Location/Qualifiers
FT   CDS             251348..251686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48507"
FT                   /db_xref="GOA:C1AR30"
FT                   /db_xref="InterPro:IPR025182"
FT                   /db_xref="InterPro:IPR038638"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR30"
FT                   /protein_id="BAH48507.1"
FT                   /translation="MADRVLRGSRLGAVSYETDRDHDLAPRRMAKYRCDNGEVFDIPFA
FT                   DDAEIPGTWLCRNGLEGTLVEGTAPEAKKVKPPRTHWDMLLERRSKEELEELLKERLDL
FT                   LKAKRRGA"
     MADRVLRGSR LGAVSYETDR DHDLAPRRMA KYRCDNGEVF DIPFADDAEI PGTWLCRNGL        60
     EGTLVEGTAP EAKKVKPPRT HWDMLLERRS KEELEELLKE RLDLLKAKRR GA               112
//

If you have problems or comments...

PBIL Back to PBIL home page