(data stored in ACNUC7421 zone)

EMBL: AP011115.PE261

AP011115.PE261       Location/Qualifiers
FT   CDS             complement(252246..281813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02610"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48508"
FT                   /db_xref="GOA:C1AR31"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR31"
FT                   /protein_id="BAH48508.1"
FT                   /translation="MGSFPPPEWEMRTNKVVEAVPGGEVTAHGRIPDGAFPLSAAQRGM
FT                   WFAQQLDPSVPVTIAQCVELVGALDVALLSESLITAGRELGSAFLRLVEVDGVPYQLID
FT                   PTLEASVSVVDLQHEPDPRAAATEWMRQEYTTPLDVCRDRLVTSAVLRIGPNHHYWYCR
FT                   VHHVALDGMGSVTLVDRTAELYTAAVEGRAVAPSKAAELTDVARVDDEYRTSSRYLADG
FT                   EYWSERVSSIGEPHSLVDRTAPARARSRTTGGQILGPLADHLDAATNRHDSSAAFEVIA
FT                   AFAAYLARMTGREEVAVSLPVTARTTALLRRSGGMVSNVVPLRLDVRPDMTNTDLVAAV
FT                   RLEVTGALRHQRYPHMDIRRDAATDHQGFYGPLINVMLFHNEITLGSIVGRLELLSTGP
FT                   ISDLAVNVYHGVAGTSINLDLEANPDLYSDDALAAHHARFTRFLGAFLTSDTGTPRRIG
FT                   DLEILDEDECRILVPAAGRAGFAPVALPDLLAGAVRSNPDGDALVAPGHGTPDVTLSYR
FT                   ALDEESNRLARLLIDLQVGPEVSVALALPRSVESVSSVWAVAKSGAAFVPVDPGYPFER
FT                   IVHMLEDCGAPIGITTAALRAGLPDSTLWLVLDDDEFVSAVAAYPADPVTDADRTGVLM
FT                   VDHPAYVIYTSGSTGRPKGVAVSHRGVVNLAADERDRLGVSADSRVLHFASPSFDASVF
FT                   ELVMAVCAGAALVVAPTTMFGGVELAEFLAEHEVSHAFCTPAALASLDHRGLDHLTTVV
FT                   VAGDVCPPELVAKWAPGRIMVNAYGPTETTIMSSATGPMVPGQPVTIGSATVGVDLVVL
FT                   DHRLRPVPVGVRGELYVLGSSLARGYVHRAGLTAERFVASPFGTGGRMYRTGDVVRWGT
FT                   VPDGPPVLEFLGRSDFQVKIRGFRIELGEIDAALSAHPVVEFAHTVGYDDGSGRSRLVS
FT                   YVLPAPGTDVETRVLSEFVGTRLPGYMVPSSIMVLNMLPLTPAGKLDRNALPAPVFAAR
FT                   SADIVRPRTVSEEILLGIFRDVLGLPELSVDTSFFELGGNSLMATQVVSRVNAALDVRI
FT                   GVRDLFQSPSVSKLAATVANAGPQSDPRPALEPRERPDRMPLSVAQQRMWFLNQFDTAS
FT                   AAYNLPIALRLAGALDREALRAALGDVQERHEALRTVFPDSADGPHQLIKPAVSVLADT
FT                   DPLDVDPESLTAAVTALGSTGFDLTADTPLRAGLFREAPERHVLVLVVHHIAADGWSMT
FT                   PLAADVMVAYAARAAGHAPIWAPLPVQYVDYSLWQRDLLGSEDDPNSLSAKQIAHWRAA
FT                   LAGVPQLIELPTDRTRPAEMSHRGGRVEFTIPADVHGRLVDLAQSTGTTPFMVTHAALA
FT                   VLLRRLGAGSDIVIGTPVAGRGEEALDHLVGMFVNTLALRTTVDLGDTFEDVLARTRAA
FT                   DLAAFQHGDVPFERLVEVLSPARSSAHHPLFQVMLTFQNTANTRVELDGLEVEAAEIDV
FT                   QVAKFDLHLTVAENVDAAGNAAGLAVQLSYATDLFDHSTVVSIGERFGRLLDAVSGNPP
FT                   VAVGDLDLLDSREHAALTAANATHRPVPADTLASLFAAQAAATPDAVALVFDDRRLTYA
FT                   EFDERTDRLARHLIRTGVGPESVVAVGMRRSIDLLVAVYAIVKAGAAYLPIDPDHPAER
FT                   TAYVLDTAQPVCVLTRAADDTTFRTAAPVVNIDTLDLPDQDPTPISTALTAGNTAYVIF
FT                   TSGSTGRPKGVAVTHGAIVNRLLWMQHEYGLTPDDAVMQKTPVTFDVSVWELFWPLQVG
FT                   ASMVIAAPDGHRDPDYLATLIRRHRVTTMHFVPSMLSVFTAEPAVAVCDSLRLVFCSGE
FT                   ALTPEQVSRFRAVSGAGLHNLYGPTEAAVDVTYWETGAADALSVPIGRPVWNTQVHVLD
FT                   ARLHPVPNGVAGEVYLAGDQLARGYLNRADLSSDRFVANPFVAGGRMYRTGDLVRRRGD
FT                   GALEYLGRTDFQVKLRGQRIELGEIESALEAHPDVVQAVVVVHRDERGDEALVAYLVGR
FT                   RAAEWSDVRAHLSTRVPSYMIPARVVHLDTLPLSVNGKLDRKALPPPTLDTATAEYIAP
FT                   QTPAEVVVAGVFAEILGVERVGTHDHFFDLGGNSLVATRLVSRLRIALGVPVSLRDVFD
FT                   APTVGALAHRLDRVDPAAHPAPPALTPQERPEQVPLSPAQQRVWFLNQFDTSSPVYNLP
FT                   LAVRFSGGLDVTALRRALRAVLHRHESLRTVFPASDSSPWQRILDEHDVDLDLTVVEAT
FT                   DAELAAAIRGFALAGFDVTTEIPVRARLLRVRNDEHVLVLVVHHIAADGWSFAPLSRDL
FT                   MVAYAAHSGGRDLQWAPLPVQYADYTLWQRELLGEKHDPDSRAARQLAYWATTLAGLPD
FT                   SLDLPTDRPRPSVASKHGATVSWEISTELHERLLTLARTQDTTLFMVAHSALSVLLSRL
FT                   SATTDIAIGTPVAGRGDRDLDDLVGMFVNTLVLRAQLDPASSFAELLQQVREVDLAAFA
FT                   HTDVPFERLVEHLNPTRTAAHHPLFQVALFFQNHAPAHLELPGLSVSSQPILPDVAAFD
FT                   LQLVLTDTRDADGTPGPITAEFNYATELFDESTIRSFGSQFVRILDAVTMAPHTPVGDI
FT                   AIAHPAARIRELSGWNATDHDVPDTTLPDLFGAQAARTPDAPAVVFDGASLTYREFDEH
FT                   ANRLARYLISCGVGPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADRIGYVL
FT                   QSAGPVCVLTTTADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNTAYVIYT
FT                   SGSTGKPKGVAVPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFFWPLQVGA
FT                   ALVLAGPDGHRDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLRHVFVIGEA
FT                   LPPETASRFRDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEWNTQAYVLDS
FT                   RLHPVAAGVPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYRTGDLVRRRRD
FT                   GVLEYIGRTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATTGDHLVAYVVPA
FT                   PDRVADTAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALPAPEFTSDATEYV
FT                   APSTSVERAVASVFCAVLGLERVSVRDSFFELGGNSLIATQLVSRLRGELDVPVTVRDL
FT                   FETPTVAELAARLSQSTGADTRPALIRRERPERIPLSPAQQRMWFLNQFDPSSPAYNLP
FT                   FAVRFTGPLDRVALEAAVADLVERHESLRTVFPDSATGPHQVVRDTADAPPNLTVADIA
FT                   EDELETVLARFFTTGFDVTTDLPVRVTLLRVSAHEHVLALVVHHICGDGWSMAPMVRDV
FT                   MVAYTARTRGERPAWTPLPVQYADYALWQRELLGDESDPDTLAARQLDYWTDTLAGIPD
FT                   ELELPTDHPRPAEQSYRGSHVDFDIDASAHRALAALAQSRRATLFMVMHTALAVLLGRL
FT                   SASSDVTIGTPVAGRGEPELDDLIGMFVNTVALRTHVDPGSAFTDVLDHVRDVDLAAFS
FT                   RADVPFERLVEVLSPTRHAARHPLFQVMLTFQNLEQTALELDGLTLRGLGTDIDVAKFD
FT                   LHLTLVERFDPAGRPDGMTAQLTYATDLFDADTADSIAARFTTILGAVTTDATTRVGDI
FT                   ALLGADERAALTLWNSTEHAVPATTLPVLFDAQVARTPGAPALVLDGASLTYREFDEHA
FT                   NRLARYLVSCGVGPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADRIGYVLQ
FT                   SAGPVCVLTTAADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNTAYVIYTS
FT                   GSTGKPKGVAVPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFFWPLQVGAA
FT                   LVLAGPDGHRDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLRHVFVIGEAL
FT                   PPETASRFRDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEWNTQAYVLDSR
FT                   LHPVAAGVPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYRTGDLVRRRRDG
FT                   VLEYIGRTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATTGDHLVAYVVPAP
FT                   DRVADTAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALPAPEFSSDATEYVA
FT                   PRNEVEQALAGVFADVLGAGRVGVHDSFFDLGGNSLSVTRLAARITETTGTRLSVRDVF
FT                   EAPTVADLAVRIDPTARDVRPALTAAPRPARIPLSLAQQRMWLLNQFDADSPAYNLPFA
FT                   VRLSGVVDTAALAAAFDDVVERHESLRTVFPDGGDGPEQVVLAVTDVSVTLPPVDVTEA
FT                   DLPGRMAALASRTFDVTAETPVRATLFRTAPTEHVLAISLHHIAADGWSFGPLGRDVMV
FT                   AYAARTDGHAPQWAPFEVQYADFSVWQRDVLGSEDDPESVLATQLGFWTRTLAGAPDEL
FT                   PLPFDRPRPAQPTFAGGSVGFDIDPETHRRIRSLARDHGATTFMVAHTAFALLMARLSA
FT                   TDDVAIGTPIAGRGERALDDLVGMFVNTLVLRTAVNGGATFAEMLRTVRDTDLAAFAHA
FT                   DVPFERLVDALAPTRTAARHPIYQVALSMNPLQSPDYELPGLRIGVEDVDPGVAKIDLQ
FT                   LTLGEELDHTGAPSGMRAEFIYATDLFDESTISDVASRLQRILEAVTSDPDTLVGDLDL
FT                   LHDAERDALVPASGRPGLIPVTLPDLLAGAVRSNPDGDALVAPGHGTSDGTLSYRALDA
FT                   TSNRLARLLIDLQVGPEVSVALALPRSRESVVATWAVTKSGAAFVPVDPNYPADRIAFM
FT                   LEDCGAPIGITTAALRENLPDSTLWLVLDDDAVIEALTSYSSEPVQDSDRVAALSVDHP
FT                   AYLIYTSGSTGRPKGVAVSHRGVVNLAADERVRLGVLSESRVLHFASPSFDASVFELMM
FT                   AVSAGATLVVAPTTIFGGEELAEFLAEQEVSHAFCTPAALASVNHRGLDSLTTVVVAGD
FT                   VCPPELVARWAPGRVMVNAYGPSEATIMSSATGPLVPGQPVTIGSPTVGVDLVVLDSRL
FT                   RPVPAGVRGELYVLGSSLARGYVRRSGLTAERFVASPFGSGGRMYRTGDVVRWVTAPDR
FT                   PPVLEFLGRSDFQVKIRGFRIELGEIDAALTAHPVVEFAHTIGFDDGSGHDRLVSYVLP
FT                   APAAEVDSRVLSEFVGERLPGYMVPSSIMVLDSLPLTPAGKLDRNALPTPVFAQRSEFT
FT                   APQTPAEQAIAAVFADVVGEPSIGLDDNFFDLGGNSLSATQVVSRVGSALGTRISVRTL
FT                   FDNPTVRALATAAASDTTAERPALVAGERPATIPLSPAQQRMWFLNQFDTTAAAYTIPL
FT                   ALRMSGRIDVATLRTALGDVLARHEALRTVYPATENGAHQVIVPVESIPLDLTPTRLSG
FT                   EDLSGAILRHASAGFDVTTDLPLRVHLFRESRSEHVLLFVVHHISADGWSFIPLASDVM
FT                   TSYAARTAGDAPVWNALPVQYADYAMWQRHLLGDSDDPQSLAASQIAYWKRTLAGLPDQ
FT                   VALPTDRPRPPAPSNLGGTARLTLDGDLHRQLHELARAHHASLFMVVHTALAALLSRLG
FT                   AGPDVAVGTSVAGRGEQSLDGLVGMFVNTLVLRTDVHPDSTGAALLEQVRRVDLEAFSH
FT                   VEVPFEQLVDAINPTRSTAFHPLFQVALALQNLQTPTLELPGLEVSALDIESPIAKFDL
FT                   NFVLGERHDEDGNPAGLDLELGYAKDLFDADTASRIGESFVRVLSGLAHDPRTPVGDLD
FT                   LLGDDARLRLLAQSHGATRETVHSTLVGLLDEQVRATPSAPAVRWRDTALTYAEFDACA
FT                   NRLARKLIADGVGPDAVVAVEIPRSLDLLVAVHAVVKAGGAYTPLDPGQPEQRNRDIVE
FT                   QSGASLVLTSSELLRQTGATRHGVRAIAPDALDPAEFGGEPIRAAERIAPLRPDNTAYV
FT                   LFTSGSTGRPKGVAVSHAAITAQLEWLREQYALGTADTMLLKTPVTFDVSVWECFAPLA
FT                   AGARLVIADPDGHRDPEYLAEIVRTHGVTVVHFVPAMLAALTSGPGLTDMPALRHVLVG
FT                   GEAVSPETIDDFRASHPAEIDNTYGPTEAAVTTTFFAARSDNSDTVPIGLPVWNTSTLV
FT                   LDDRLRPVPAGVAGELYLGGVQLARGYLGRPDLTAERFVADPFSTSGARLYRTGDLVRW
FT                   TAAGRLEYLGRTDFQVKVRGFRIELGEIVSALLRHEDVDQAVVVPHSDPHTGEHLVGYV
FT                   VPRGAVALDCDAVLAEAAGSLPSYMVPSLLVPLTELPLTPNGKVDRNALPAPVFAGKAE
FT                   YTAPRTESERVVAAVFAELLGVSRVGVDDNFFELGGNSLSATKLSTRIGVATQTRIAIR
FT                   DVFDAPTVAALARRLDQHGPSTAIAPLTAAVRPGRIPLSLAQQRMWFLNQFETSSPAYN
FT                   LPAAVRLTGSLDTAALAAAIGDLIARHESLRTVFPDSRGGPHQVILEPGDFTPDVAPVH
FT                   VSETGLRADLQEFLLAGFDVSEAVPLRVKVYSLGPAEHVLALVVHHISADGASMEPLIR
FT                   DVMIAYGSRAAGHPPTWAPLPVQYADYALWQRTVLGSESEPGSLAAAQLDYWTRALAGV
FT                   PDQLYLPGDRGRPAVPTHRGAATRFTLDAGTHRALTELARAHGASLFMVAHAALSVLLG
FT                   RLSTTADIAVGTAVAGRGRVELDDIIGMFVNTLVLRTTLDPGASFVALLAQTRTVDLEA
FT                   FAHADLPFERLVEVLSPVRSTSHHPLFQVALGVQAVSADGLELDGLSVTPLTLDASIAK
FT                   FDLHFTLTERLDDTAEPAGIDAELIYATDIFDESTAAGYATRLRRIFEAVVADPQRPIG
FT                   DIPVLGEDEHAALTPVRGADPRPVQMLPEILADAVAAAPDGLAVVFDGAGLTYRDLDER
FT                   SNQLARLLVDRGVGPETSVALALPRSFESVVAVWAVAKTGAAFVPVDPGYPADRIVHMV
FT                   QDSGAMVGITVSAKRALLPDSIRWMLLDDPALEVRCTHESRLPLTNRDRMRPILSDQVA
FT                   YVIYTSGSTGRPKGVAVTHRGLMNLVTDERELLAVTSRSRTLHFASPSFDASVFEMLMA
FT                   LGAGATMVIAPPTIYGGSELAELLAAERITHAFSTPAALASVDHHGLDELAVVVVAGDV
FT                   CPPELVARWAPGRRLVNAYGPSEATIMSSITEPLRAGEPVTIGGPSRGVRALVLDGRLR
FT                   PVPVGVPGELYVGGPSLARGYLGRPGLTAERFVADPYGEPGDLMYRTGDLVRWREDRVL
FT                   DFVGRTDHQVKIRGFRIELGEIDAALTAHPQIEYATTIGYEHPNGETSLVAYVLPFTGE
FT                   DVDRVEVANFVGRTLPAYMVPASVTLLDALPLTPAGKLDRSALPEPIFAAAATTFEAPR
FT                   NPMEVIVAGIFADILALPEIGIHDSFFDLGGNSLLATQVVSRINAALDVHVGVREVFES
FT                   PTVAALAARITETTTHGARRPALTARARPEHIPLSLAQQRMWFINQFDTASPAYNLPVA
FT                   LRLSGEVDLRAMQIAIADLVGRHEALRTVYPDSGDGPHQVIVPAADAVPDLTPVTAHPD
FT                   DVLERVLALVTTGFDVTSDVPLRARMYRVGADDYVLVMVAHHISGDGWSLAPLARDVML
FT                   AYTARTEGHVPLWTPLPVQYADYSLWQRELLGDEADPESVAAEQIAYWTRTLDGLPDRL
FT                   SLPTDRPRPAVASHRGAHVPFTIDAATHRALLTLARGRNTSLFMVMHTALAVLLARLSN
FT                   ESDIAVGAPIAGRGEESLDELVGMFVNTLVLRTHVDLASSFADSLNVARSTDLSAFAHS
FT                   DIPFERLVDVLNPARSRSHHPLFQVAFSFQNLATATLELPGLHVEGLDVPNTISTFDLH
FT                   LTLSEKHDADGTPDVIEAQFTYATDLFDDTTVRAFAERFTRILESVVRDPDLAVGAIDL
FT                   LGGAERQSVIAEFNDTAVDLPPTTLADLFSAQAVRTPDYPAVFFEGTELTYSEFDRRVD
FT                   ALAHRLIDSGVGPDTVVGLAMNRSIELLAGMYAVLRAGGAYLPIDLGHPADRLAYVLET
FT                   ARPVCVLTTSPDGFTAENVPVIEIDTLDLTGSPRGPVTDAHRRAPLRPENTAYLIFTSG
FT                   STGRPKGVAVSHAAIANQLRWKQHEYPLDTTDAVVQKTPVTFDLSVWELFWPLMSGARL
FT                   VISRPDGHRDPAYLADLMRQQRVTTAHFVPSLLEAFIPDAGEQPTLRRVLCIGEALPVD
FT                   TAARFRSRFASVALHNLYGPTEAAVSVTAWTHTDVDTDTVPIGGPEWNTQAFVLDARLN
FT                   PVPVGVAGELYLAGDQLARGYVARTDLTAERFVANPFGAPGARLYRTGDVVRWRIRGTT
FT                   GVLEYLERSDFQVKVRGFRIELGEIESALIRSAGVGQAVVVAHRNPHTGTALVAYVVPE
FT                   DGSTVDPTAVLADVGAAVPSYMVPAALVVLAELPLTANGKLDRKALPAPDFASAAAEYR
FT                   APATPTEEIVAAVYADVLGVEQVGTAANFFDLGGNSLVATRVVARLSETLGRRVEIRSL
FT                   FEAPAVGALAALLDSTDATAPTRPALTPAVRPELLPLSSAQQRMWFLNRFDPDSAVHNI
FT                   PVAVRLSGVLDVDALQHAVADVLHRHESLRTIYPDSADGPHQVILSTDRVGAETSVDAA
FT                   DEAALPALIADLVTTGFDVTAEVPVRVRIFRISATEHVLAVVVHHISGDGWSMAPMVRD
FT                   VMAAYSARSAGTSPDWAPLPVQYADYALWQRDLLGDETDPDSVAARQLAFWTQTLAGAP
FT                   DQLDLPTDRPRPAVASYRGGTVDFTVPADLHGTVVGAARDANASVFMVVHSALAVLLSR
FT                   LAGSGDISIGTPVAGRGERELDDLIGMFVNTLVLRQHVDGGRTFAELLADVRETDLAAF
FT                   SHADVPFERLVEVVNPSRSTGRHPLFQVMLTFQNLDQESLELGDLSVSGVDLDVDIAKF
FT                   DLQLTLMEQFDSEGGPDGIAARLTYAADLFDEPSAHVFGQRFLQVLRAAVDGPDTAVGD
FT                   LDVLGRGERKQIAGTNATAHPVLAGTLASLFDTAVAADPDRIAVVFDRDELTYANFDAR
FT                   VNRLARRLIEQGVGPESVVAVAMRRSIDLLVGIYAVVKAGGAYLPIDPDHPVERTAYVL
FT                   DTARPACVLVSGAGLADSGSVPVVDIASEDLSRYGSAPVTDRDRLRPLTAANTAYVIFT
FT                   SGSTGRPKGVAVTHGAIVNRLLWMQHEYALTSADVVLQKTPVTFDVSVWELFWPLQVGA
FT                   SMVIAAPDGHRDPRYLTGLVQERHVTTMHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEA
FT                   LTPEQVSRFRGVSGAGLHNLYGPTEAAVDVTFWETGESDTHSVPIGRPVWNTQVHVLDA
FT                   RLHPVPNGVAGELYLAGEQLARGYLGRVDLTSDRFVANPFVAGGRMYRTGDLVRRRGDG
FT                   ALEYLGRTDFQVKLRGQRIELGEIESALEAHPDVVQAVVVVHRDERGDEALVAYLVGRR
FT                   AAEWSDVRAHLSTRVPSYMIPARVVHLDTLPLSVNGKLDRKALPAPEVRSAAAEYQPPR
FT                   SAAERAVATVFGEVLEIDRVGATDSFFDLGGNSLIATRVAAALGSELGIDFPLQWMFSD
FT                   PTPRSLGQRIQNAAIDGVPGAGASLDVLLPIRTRGTAEPVFCVHPFIGLAWSYAGLSRE
FT                   LTEDRPIYGLQSPALTEAEPHPGTITDFADRYVREIRSIQPHGPYHLVGWSLGGVIAHE
FT                   MAVQLQEAGEEVRLLGLLDSYVGLDRSVENTATTADLLGGAGLDLPEDGVLDELSPDGQ
FT                   FDAERAAALLRVVGGPLAALTAPELDRIYRNAQQAPDLIDAHRPRVFDGELVFFTAALD
FT                   DGFHVDPVTCWGPYVRGRIDEHPVDATHWTMTTPDALAAIAPHLARTQRRPRHAAPDPG
FT                   RDTDPDDSANRPHSVR"
     MGSFPPPEWE MRTNKVVEAV PGGEVTAHGR IPDGAFPLSA AQRGMWFAQQ LDPSVPVTIA        60
     QCVELVGALD VALLSESLIT AGRELGSAFL RLVEVDGVPY QLIDPTLEAS VSVVDLQHEP       120
     DPRAAATEWM RQEYTTPLDV CRDRLVTSAV LRIGPNHHYW YCRVHHVALD GMGSVTLVDR       180
     TAELYTAAVE GRAVAPSKAA ELTDVARVDD EYRTSSRYLA DGEYWSERVS SIGEPHSLVD       240
     RTAPARARSR TTGGQILGPL ADHLDAATNR HDSSAAFEVI AAFAAYLARM TGREEVAVSL       300
     PVTARTTALL RRSGGMVSNV VPLRLDVRPD MTNTDLVAAV RLEVTGALRH QRYPHMDIRR       360
     DAATDHQGFY GPLINVMLFH NEITLGSIVG RLELLSTGPI SDLAVNVYHG VAGTSINLDL       420
     EANPDLYSDD ALAAHHARFT RFLGAFLTSD TGTPRRIGDL EILDEDECRI LVPAAGRAGF       480
     APVALPDLLA GAVRSNPDGD ALVAPGHGTP DVTLSYRALD EESNRLARLL IDLQVGPEVS       540
     VALALPRSVE SVSSVWAVAK SGAAFVPVDP GYPFERIVHM LEDCGAPIGI TTAALRAGLP       600
     DSTLWLVLDD DEFVSAVAAY PADPVTDADR TGVLMVDHPA YVIYTSGSTG RPKGVAVSHR       660
     GVVNLAADER DRLGVSADSR VLHFASPSFD ASVFELVMAV CAGAALVVAP TTMFGGVELA       720
     EFLAEHEVSH AFCTPAALAS LDHRGLDHLT TVVVAGDVCP PELVAKWAPG RIMVNAYGPT       780
     ETTIMSSATG PMVPGQPVTI GSATVGVDLV VLDHRLRPVP VGVRGELYVL GSSLARGYVH       840
     RAGLTAERFV ASPFGTGGRM YRTGDVVRWG TVPDGPPVLE FLGRSDFQVK IRGFRIELGE       900
     IDAALSAHPV VEFAHTVGYD DGSGRSRLVS YVLPAPGTDV ETRVLSEFVG TRLPGYMVPS       960
     SIMVLNMLPL TPAGKLDRNA LPAPVFAARS ADIVRPRTVS EEILLGIFRD VLGLPELSVD      1020
     TSFFELGGNS LMATQVVSRV NAALDVRIGV RDLFQSPSVS KLAATVANAG PQSDPRPALE      1080
     PRERPDRMPL SVAQQRMWFL NQFDTASAAY NLPIALRLAG ALDREALRAA LGDVQERHEA      1140
     LRTVFPDSAD GPHQLIKPAV SVLADTDPLD VDPESLTAAV TALGSTGFDL TADTPLRAGL      1200
     FREAPERHVL VLVVHHIAAD GWSMTPLAAD VMVAYAARAA GHAPIWAPLP VQYVDYSLWQ      1260
     RDLLGSEDDP NSLSAKQIAH WRAALAGVPQ LIELPTDRTR PAEMSHRGGR VEFTIPADVH      1320
     GRLVDLAQST GTTPFMVTHA ALAVLLRRLG AGSDIVIGTP VAGRGEEALD HLVGMFVNTL      1380
     ALRTTVDLGD TFEDVLARTR AADLAAFQHG DVPFERLVEV LSPARSSAHH PLFQVMLTFQ      1440
     NTANTRVELD GLEVEAAEID VQVAKFDLHL TVAENVDAAG NAAGLAVQLS YATDLFDHST      1500
     VVSIGERFGR LLDAVSGNPP VAVGDLDLLD SREHAALTAA NATHRPVPAD TLASLFAAQA      1560
     AATPDAVALV FDDRRLTYAE FDERTDRLAR HLIRTGVGPE SVVAVGMRRS IDLLVAVYAI      1620
     VKAGAAYLPI DPDHPAERTA YVLDTAQPVC VLTRAADDTT FRTAAPVVNI DTLDLPDQDP      1680
     TPISTALTAG NTAYVIFTSG STGRPKGVAV THGAIVNRLL WMQHEYGLTP DDAVMQKTPV      1740
     TFDVSVWELF WPLQVGASMV IAAPDGHRDP DYLATLIRRH RVTTMHFVPS MLSVFTAEPA      1800
     VAVCDSLRLV FCSGEALTPE QVSRFRAVSG AGLHNLYGPT EAAVDVTYWE TGAADALSVP      1860
     IGRPVWNTQV HVLDARLHPV PNGVAGEVYL AGDQLARGYL NRADLSSDRF VANPFVAGGR      1920
     MYRTGDLVRR RGDGALEYLG RTDFQVKLRG QRIELGEIES ALEAHPDVVQ AVVVVHRDER      1980
     GDEALVAYLV GRRAAEWSDV RAHLSTRVPS YMIPARVVHL DTLPLSVNGK LDRKALPPPT      2040
     LDTATAEYIA PQTPAEVVVA GVFAEILGVE RVGTHDHFFD LGGNSLVATR LVSRLRIALG      2100
     VPVSLRDVFD APTVGALAHR LDRVDPAAHP APPALTPQER PEQVPLSPAQ QRVWFLNQFD      2160
     TSSPVYNLPL AVRFSGGLDV TALRRALRAV LHRHESLRTV FPASDSSPWQ RILDEHDVDL      2220
     DLTVVEATDA ELAAAIRGFA LAGFDVTTEI PVRARLLRVR NDEHVLVLVV HHIAADGWSF      2280
     APLSRDLMVA YAAHSGGRDL QWAPLPVQYA DYTLWQRELL GEKHDPDSRA ARQLAYWATT      2340
     LAGLPDSLDL PTDRPRPSVA SKHGATVSWE ISTELHERLL TLARTQDTTL FMVAHSALSV      2400
     LLSRLSATTD IAIGTPVAGR GDRDLDDLVG MFVNTLVLRA QLDPASSFAE LLQQVREVDL      2460
     AAFAHTDVPF ERLVEHLNPT RTAAHHPLFQ VALFFQNHAP AHLELPGLSV SSQPILPDVA      2520
     AFDLQLVLTD TRDADGTPGP ITAEFNYATE LFDESTIRSF GSQFVRILDA VTMAPHTPVG      2580
     DIAIAHPAAR IRELSGWNAT DHDVPDTTLP DLFGAQAART PDAPAVVFDG ASLTYREFDE      2640
     HANRLARYLI SCGVGPESRV ALAMRRSLDL VVGMYAVVKA GGAYVPVDPD HPADRIGYVL      2700
     QSAGPVCVLT TTADRGALPS GDVVTLDCLD LSDFSGAPVT DADRVYPLRA DNTAYVIYTS      2760
     GSTGKPKGVA VPHAAIVNQL LWMQSQYALT GRDVVLQKTA TTFDVSVWGF FWPLQVGAAL      2820
     VLAGPDGHRD PDYLARTIDE LGVTVTDFVP SMLDVFVASV PADSCSSLRH VFVIGEALPP      2880
     ETASRFRDLS SAGLHNLYGP TEAAVSVTYW ETSDADTVTV PIGVPEWNTQ AYVLDSRLHP      2940
     VAAGVPGELY LGGVQLARGY LGRVDLTSDR FVANPFGGAG ARMYRTGDLV RRRRDGVLEY      3000
     IGRTDFQVKF RGQRIELGEI ETVLRSHPGV TGAAVVVYSD ATTGDHLVAY VVPAPDRVAD      3060
     TAEIRRHASG SLPSYMVPSA VVLLDEFPLN TSGKLDRKAL PAPEFTSDAT EYVAPSTSVE      3120
     RAVASVFCAV LGLERVSVRD SFFELGGNSL IATQLVSRLR GELDVPVTVR DLFETPTVAE      3180
     LAARLSQSTG ADTRPALIRR ERPERIPLSP AQQRMWFLNQ FDPSSPAYNL PFAVRFTGPL      3240
     DRVALEAAVA DLVERHESLR TVFPDSATGP HQVVRDTADA PPNLTVADIA EDELETVLAR      3300
     FFTTGFDVTT DLPVRVTLLR VSAHEHVLAL VVHHICGDGW SMAPMVRDVM VAYTARTRGE      3360
     RPAWTPLPVQ YADYALWQRE LLGDESDPDT LAARQLDYWT DTLAGIPDEL ELPTDHPRPA      3420
     EQSYRGSHVD FDIDASAHRA LAALAQSRRA TLFMVMHTAL AVLLGRLSAS SDVTIGTPVA      3480
     GRGEPELDDL IGMFVNTVAL RTHVDPGSAF TDVLDHVRDV DLAAFSRADV PFERLVEVLS      3540
     PTRHAARHPL FQVMLTFQNL EQTALELDGL TLRGLGTDID VAKFDLHLTL VERFDPAGRP      3600
     DGMTAQLTYA TDLFDADTAD SIAARFTTIL GAVTTDATTR VGDIALLGAD ERAALTLWNS      3660
     TEHAVPATTL PVLFDAQVAR TPGAPALVLD GASLTYREFD EHANRLARYL VSCGVGPESR      3720
     VALAMRRSLD LVVGMYAVVK AGGAYVPVDP DHPADRIGYV LQSAGPVCVL TTAADRGALP      3780
     SGDVVTLDCL DLSDFSGAPV TDADRVYPLR ADNTAYVIYT SGSTGKPKGV AVPHAAIVNQ      3840
     LLWMQSQYAL TGRDVVLQKT ATTFDVSVWG FFWPLQVGAA LVLAGPDGHR DPDYLARTID      3900
     ELGVTVTDFV PSMLDVFVAS VPADSCSSLR HVFVIGEALP PETASRFRDL SSAGLHNLYG      3960
     PTEAAVSVTY WETSDADTVT VPIGVPEWNT QAYVLDSRLH PVAAGVPGEL YLGGVQLARG      4020
     YLGRVDLTSD RFVANPFGGA GARMYRTGDL VRRRRDGVLE YIGRTDFQVK FRGQRIELGE      4080
     IETVLRSHPG VTGAAVVVYS DATTGDHLVA YVVPAPDRVA DTAEIRRHAS GSLPSYMVPS      4140
     AVVLLDEFPL NTSGKLDRKA LPAPEFSSDA TEYVAPRNEV EQALAGVFAD VLGAGRVGVH      4200
     DSFFDLGGNS LSVTRLAARI TETTGTRLSV RDVFEAPTVA DLAVRIDPTA RDVRPALTAA      4260
     PRPARIPLSL AQQRMWLLNQ FDADSPAYNL PFAVRLSGVV DTAALAAAFD DVVERHESLR      4320
     TVFPDGGDGP EQVVLAVTDV SVTLPPVDVT EADLPGRMAA LASRTFDVTA ETPVRATLFR      4380
     TAPTEHVLAI SLHHIAADGW SFGPLGRDVM VAYAARTDGH APQWAPFEVQ YADFSVWQRD      4440
     VLGSEDDPES VLATQLGFWT RTLAGAPDEL PLPFDRPRPA QPTFAGGSVG FDIDPETHRR      4500
     IRSLARDHGA TTFMVAHTAF ALLMARLSAT DDVAIGTPIA GRGERALDDL VGMFVNTLVL      4560
     RTAVNGGATF AEMLRTVRDT DLAAFAHADV PFERLVDALA PTRTAARHPI YQVALSMNPL      4620
     QSPDYELPGL RIGVEDVDPG VAKIDLQLTL GEELDHTGAP SGMRAEFIYA TDLFDESTIS      4680
     DVASRLQRIL EAVTSDPDTL VGDLDLLHDA ERDALVPASG RPGLIPVTLP DLLAGAVRSN      4740
     PDGDALVAPG HGTSDGTLSY RALDATSNRL ARLLIDLQVG PEVSVALALP RSRESVVATW      4800
     AVTKSGAAFV PVDPNYPADR IAFMLEDCGA PIGITTAALR ENLPDSTLWL VLDDDAVIEA      4860
     LTSYSSEPVQ DSDRVAALSV DHPAYLIYTS GSTGRPKGVA VSHRGVVNLA ADERVRLGVL      4920
     SESRVLHFAS PSFDASVFEL MMAVSAGATL VVAPTTIFGG EELAEFLAEQ EVSHAFCTPA      4980
     ALASVNHRGL DSLTTVVVAG DVCPPELVAR WAPGRVMVNA YGPSEATIMS SATGPLVPGQ      5040
     PVTIGSPTVG VDLVVLDSRL RPVPAGVRGE LYVLGSSLAR GYVRRSGLTA ERFVASPFGS      5100
     GGRMYRTGDV VRWVTAPDRP PVLEFLGRSD FQVKIRGFRI ELGEIDAALT AHPVVEFAHT      5160
     IGFDDGSGHD RLVSYVLPAP AAEVDSRVLS EFVGERLPGY MVPSSIMVLD SLPLTPAGKL      5220
     DRNALPTPVF AQRSEFTAPQ TPAEQAIAAV FADVVGEPSI GLDDNFFDLG GNSLSATQVV      5280
     SRVGSALGTR ISVRTLFDNP TVRALATAAA SDTTAERPAL VAGERPATIP LSPAQQRMWF      5340
     LNQFDTTAAA YTIPLALRMS GRIDVATLRT ALGDVLARHE ALRTVYPATE NGAHQVIVPV      5400
     ESIPLDLTPT RLSGEDLSGA ILRHASAGFD VTTDLPLRVH LFRESRSEHV LLFVVHHISA      5460
     DGWSFIPLAS DVMTSYAART AGDAPVWNAL PVQYADYAMW QRHLLGDSDD PQSLAASQIA      5520
     YWKRTLAGLP DQVALPTDRP RPPAPSNLGG TARLTLDGDL HRQLHELARA HHASLFMVVH      5580
     TALAALLSRL GAGPDVAVGT SVAGRGEQSL DGLVGMFVNT LVLRTDVHPD STGAALLEQV      5640
     RRVDLEAFSH VEVPFEQLVD AINPTRSTAF HPLFQVALAL QNLQTPTLEL PGLEVSALDI      5700
     ESPIAKFDLN FVLGERHDED GNPAGLDLEL GYAKDLFDAD TASRIGESFV RVLSGLAHDP      5760
     RTPVGDLDLL GDDARLRLLA QSHGATRETV HSTLVGLLDE QVRATPSAPA VRWRDTALTY      5820
     AEFDACANRL ARKLIADGVG PDAVVAVEIP RSLDLLVAVH AVVKAGGAYT PLDPGQPEQR      5880
     NRDIVEQSGA SLVLTSSELL RQTGATRHGV RAIAPDALDP AEFGGEPIRA AERIAPLRPD      5940
     NTAYVLFTSG STGRPKGVAV SHAAITAQLE WLREQYALGT ADTMLLKTPV TFDVSVWECF      6000
     APLAAGARLV IADPDGHRDP EYLAEIVRTH GVTVVHFVPA MLAALTSGPG LTDMPALRHV      6060
     LVGGEAVSPE TIDDFRASHP AEIDNTYGPT EAAVTTTFFA ARSDNSDTVP IGLPVWNTST      6120
     LVLDDRLRPV PAGVAGELYL GGVQLARGYL GRPDLTAERF VADPFSTSGA RLYRTGDLVR      6180
     WTAAGRLEYL GRTDFQVKVR GFRIELGEIV SALLRHEDVD QAVVVPHSDP HTGEHLVGYV      6240
     VPRGAVALDC DAVLAEAAGS LPSYMVPSLL VPLTELPLTP NGKVDRNALP APVFAGKAEY      6300
     TAPRTESERV VAAVFAELLG VSRVGVDDNF FELGGNSLSA TKLSTRIGVA TQTRIAIRDV      6360
     FDAPTVAALA RRLDQHGPST AIAPLTAAVR PGRIPLSLAQ QRMWFLNQFE TSSPAYNLPA      6420
     AVRLTGSLDT AALAAAIGDL IARHESLRTV FPDSRGGPHQ VILEPGDFTP DVAPVHVSET      6480
     GLRADLQEFL LAGFDVSEAV PLRVKVYSLG PAEHVLALVV HHISADGASM EPLIRDVMIA      6540
     YGSRAAGHPP TWAPLPVQYA DYALWQRTVL GSESEPGSLA AAQLDYWTRA LAGVPDQLYL      6600
     PGDRGRPAVP THRGAATRFT LDAGTHRALT ELARAHGASL FMVAHAALSV LLGRLSTTAD      6660
     IAVGTAVAGR GRVELDDIIG MFVNTLVLRT TLDPGASFVA LLAQTRTVDL EAFAHADLPF      6720
     ERLVEVLSPV RSTSHHPLFQ VALGVQAVSA DGLELDGLSV TPLTLDASIA KFDLHFTLTE      6780
     RLDDTAEPAG IDAELIYATD IFDESTAAGY ATRLRRIFEA VVADPQRPIG DIPVLGEDEH      6840
     AALTPVRGAD PRPVQMLPEI LADAVAAAPD GLAVVFDGAG LTYRDLDERS NQLARLLVDR      6900
     GVGPETSVAL ALPRSFESVV AVWAVAKTGA AFVPVDPGYP ADRIVHMVQD SGAMVGITVS      6960
     AKRALLPDSI RWMLLDDPAL EVRCTHESRL PLTNRDRMRP ILSDQVAYVI YTSGSTGRPK      7020
     GVAVTHRGLM NLVTDERELL AVTSRSRTLH FASPSFDASV FEMLMALGAG ATMVIAPPTI      7080
     YGGSELAELL AAERITHAFS TPAALASVDH HGLDELAVVV VAGDVCPPEL VARWAPGRRL      7140
     VNAYGPSEAT IMSSITEPLR AGEPVTIGGP SRGVRALVLD GRLRPVPVGV PGELYVGGPS      7200
     LARGYLGRPG LTAERFVADP YGEPGDLMYR TGDLVRWRED RVLDFVGRTD HQVKIRGFRI      7260
     ELGEIDAALT AHPQIEYATT IGYEHPNGET SLVAYVLPFT GEDVDRVEVA NFVGRTLPAY      7320
     MVPASVTLLD ALPLTPAGKL DRSALPEPIF AAAATTFEAP RNPMEVIVAG IFADILALPE      7380
     IGIHDSFFDL GGNSLLATQV VSRINAALDV HVGVREVFES PTVAALAARI TETTTHGARR      7440
     PALTARARPE HIPLSLAQQR MWFINQFDTA SPAYNLPVAL RLSGEVDLRA MQIAIADLVG      7500
     RHEALRTVYP DSGDGPHQVI VPAADAVPDL TPVTAHPDDV LERVLALVTT GFDVTSDVPL      7560
     RARMYRVGAD DYVLVMVAHH ISGDGWSLAP LARDVMLAYT ARTEGHVPLW TPLPVQYADY      7620
     SLWQRELLGD EADPESVAAE QIAYWTRTLD GLPDRLSLPT DRPRPAVASH RGAHVPFTID      7680
     AATHRALLTL ARGRNTSLFM VMHTALAVLL ARLSNESDIA VGAPIAGRGE ESLDELVGMF      7740
     VNTLVLRTHV DLASSFADSL NVARSTDLSA FAHSDIPFER LVDVLNPARS RSHHPLFQVA      7800
     FSFQNLATAT LELPGLHVEG LDVPNTISTF DLHLTLSEKH DADGTPDVIE AQFTYATDLF      7860
     DDTTVRAFAE RFTRILESVV RDPDLAVGAI DLLGGAERQS VIAEFNDTAV DLPPTTLADL      7920
     FSAQAVRTPD YPAVFFEGTE LTYSEFDRRV DALAHRLIDS GVGPDTVVGL AMNRSIELLA      7980
     GMYAVLRAGG AYLPIDLGHP ADRLAYVLET ARPVCVLTTS PDGFTAENVP VIEIDTLDLT      8040
     GSPRGPVTDA HRRAPLRPEN TAYLIFTSGS TGRPKGVAVS HAAIANQLRW KQHEYPLDTT      8100
     DAVVQKTPVT FDLSVWELFW PLMSGARLVI SRPDGHRDPA YLADLMRQQR VTTAHFVPSL      8160
     LEAFIPDAGE QPTLRRVLCI GEALPVDTAA RFRSRFASVA LHNLYGPTEA AVSVTAWTHT      8220
     DVDTDTVPIG GPEWNTQAFV LDARLNPVPV GVAGELYLAG DQLARGYVAR TDLTAERFVA      8280
     NPFGAPGARL YRTGDVVRWR IRGTTGVLEY LERSDFQVKV RGFRIELGEI ESALIRSAGV      8340
     GQAVVVAHRN PHTGTALVAY VVPEDGSTVD PTAVLADVGA AVPSYMVPAA LVVLAELPLT      8400
     ANGKLDRKAL PAPDFASAAA EYRAPATPTE EIVAAVYADV LGVEQVGTAA NFFDLGGNSL      8460
     VATRVVARLS ETLGRRVEIR SLFEAPAVGA LAALLDSTDA TAPTRPALTP AVRPELLPLS      8520
     SAQQRMWFLN RFDPDSAVHN IPVAVRLSGV LDVDALQHAV ADVLHRHESL RTIYPDSADG      8580
     PHQVILSTDR VGAETSVDAA DEAALPALIA DLVTTGFDVT AEVPVRVRIF RISATEHVLA      8640
     VVVHHISGDG WSMAPMVRDV MAAYSARSAG TSPDWAPLPV QYADYALWQR DLLGDETDPD      8700
     SVAARQLAFW TQTLAGAPDQ LDLPTDRPRP AVASYRGGTV DFTVPADLHG TVVGAARDAN      8760
     ASVFMVVHSA LAVLLSRLAG SGDISIGTPV AGRGERELDD LIGMFVNTLV LRQHVDGGRT      8820
     FAELLADVRE TDLAAFSHAD VPFERLVEVV NPSRSTGRHP LFQVMLTFQN LDQESLELGD      8880
     LSVSGVDLDV DIAKFDLQLT LMEQFDSEGG PDGIAARLTY AADLFDEPSA HVFGQRFLQV      8940
     LRAAVDGPDT AVGDLDVLGR GERKQIAGTN ATAHPVLAGT LASLFDTAVA ADPDRIAVVF      9000
     DRDELTYANF DARVNRLARR LIEQGVGPES VVAVAMRRSI DLLVGIYAVV KAGGAYLPID      9060
     PDHPVERTAY VLDTARPACV LVSGAGLADS GSVPVVDIAS EDLSRYGSAP VTDRDRLRPL      9120
     TAANTAYVIF TSGSTGRPKG VAVTHGAIVN RLLWMQHEYA LTSADVVLQK TPVTFDVSVW      9180
     ELFWPLQVGA SMVIAAPDGH RDPRYLTGLV QERHVTTMHF VPSMLSVFTA EPAVAVCDSL      9240
     RLVFCSGEAL TPEQVSRFRG VSGAGLHNLY GPTEAAVDVT FWETGESDTH SVPIGRPVWN      9300
     TQVHVLDARL HPVPNGVAGE LYLAGEQLAR GYLGRVDLTS DRFVANPFVA GGRMYRTGDL      9360
     VRRRGDGALE YLGRTDFQVK LRGQRIELGE IESALEAHPD VVQAVVVVHR DERGDEALVA      9420
     YLVGRRAAEW SDVRAHLSTR VPSYMIPARV VHLDTLPLSV NGKLDRKALP APEVRSAAAE      9480
     YQPPRSAAER AVATVFGEVL EIDRVGATDS FFDLGGNSLI ATRVAAALGS ELGIDFPLQW      9540
     MFSDPTPRSL GQRIQNAAID GVPGAGASLD VLLPIRTRGT AEPVFCVHPF IGLAWSYAGL      9600
     SRELTEDRPI YGLQSPALTE AEPHPGTITD FADRYVREIR SIQPHGPYHL VGWSLGGVIA      9660
     HEMAVQLQEA GEEVRLLGLL DSYVGLDRSV ENTATTADLL GGAGLDLPED GVLDELSPDG      9720
     QFDAERAAAL LRVVGGPLAA LTAPELDRIY RNAQQAPDLI DAHRPRVFDG ELVFFTAALD      9780
     DGFHVDPVTC WGPYVRGRID EHPVDATHWT MTTPDALAAI APHLARTQRR PRHAAPDPGR      9840
     DTDPDDSANR PHSVR                                                       9855
//

If you have problems or comments...

PBIL Back to PBIL home page