(data stored in ACNUC7421 zone)

EMBL: AP011115.PE264

AP011115.PE264       Location/Qualifiers
FT   CDS             complement(284439..286037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48511"
FT                   /db_xref="GOA:C1AR34"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR34"
FT                   /protein_id="BAH48511.1"
FT                   /translation="MTTQLLVGGRIYSSFAPDATSMAVTDGLVSWVGDDRAARALHPGA
FT                   EVVDLGGAFVTPAFVDTHVHVTALGLNIVGLDLVGVGSLRECLDRLASFARTHSDAVIW
FT                   GHGWDESAWPEGTGPTTAQLDEAAPGRTVYLSRIDVHSAVCSTALRRSVPGLSEASGFS
FT                   SEGPLTFEAHHAARTVARSLLTAEQRSAARVAALDAIASRGIVAVHECGGPDIAGLDDF
FT                   RELLATAHGVEVRGYWGEAVTDADEARKLLDTAGAHALGGDLFIDGSLGSHTAWLSAPY
FT                   ADLDGGTGKSYLGVDEIAAHVRACTIAGIQAGFHVIGDAAVRAAVDAFAVVADELGGPA
FT                   VAAAGHRLEHAEMMTGDDAARLAQWGVIASVQPAFDALWGGTDGLYAQRLGTERALTLN
FT                   PFAAAASAGVSLALSSDAPVTPVEPWAMLRAAVHHRTPGSGISPRAAFSAATRGAWRAG
FT                   GVRDGLAGTLAPGAPASYAVWDAGELVVSAPKDSVQRWSTDPRSRVPALPRLEDDAPTP
FT                   VLLRSVHRGSVVHER"
     MTTQLLVGGR IYSSFAPDAT SMAVTDGLVS WVGDDRAARA LHPGAEVVDL GGAFVTPAFV        60
     DTHVHVTALG LNIVGLDLVG VGSLRECLDR LASFARTHSD AVIWGHGWDE SAWPEGTGPT       120
     TAQLDEAAPG RTVYLSRIDV HSAVCSTALR RSVPGLSEAS GFSSEGPLTF EAHHAARTVA       180
     RSLLTAEQRS AARVAALDAI ASRGIVAVHE CGGPDIAGLD DFRELLATAH GVEVRGYWGE       240
     AVTDADEARK LLDTAGAHAL GGDLFIDGSL GSHTAWLSAP YADLDGGTGK SYLGVDEIAA       300
     HVRACTIAGI QAGFHVIGDA AVRAAVDAFA VVADELGGPA VAAAGHRLEH AEMMTGDDAA       360
     RLAQWGVIAS VQPAFDALWG GTDGLYAQRL GTERALTLNP FAAAASAGVS LALSSDAPVT       420
     PVEPWAMLRA AVHHRTPGSG ISPRAAFSAA TRGAWRAGGV RDGLAGTLAP GAPASYAVWD       480
     AGELVVSAPK DSVQRWSTDP RSRVPALPRL EDDAPTPVLL RSVHRGSVVH ER               532
//

If you have problems or comments...

PBIL Back to PBIL home page