(data stored in ACNUC7421 zone)

EMBL: AP011115.PE265

AP011115.PE265       Location/Qualifiers
FT   CDS             complement(286056..286562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02650"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48512"
FT                   /db_xref="GOA:C1AR35"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR35"
FT                   /protein_id="BAH48512.1"
FT                   /translation="MYAALFLLYVVVEIAALVLVGHAIGAVWTVLLLLGGTLIGLLLMR
FT                   SQWRRVMDGLRRAAGGDGSPGAAVADGALVALGSALMFVPGLVTSVLGLLFLIPPTRWA
FT                   LRPVVVLLAGRRAATVAAGAEAFARAPRRGRGEVIEGEVVDEFFEGEVIDEEHRTPTRD
FT                   PRVLP"
     MYAALFLLYV VVEIAALVLV GHAIGAVWTV LLLLGGTLIG LLLMRSQWRR VMDGLRRAAG        60
     GDGSPGAAVA DGALVALGSA LMFVPGLVTS VLGLLFLIPP TRWALRPVVV LLAGRRAATV       120
     AAGAEAFARA PRRGRGEVIE GEVVDEFFEG EVIDEEHRTP TRDPRVLP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page