(data stored in ACNUC7421 zone)

EMBL: AP011115.PE266

AP011115.PE266       Location/Qualifiers
FT   CDS             286766..287383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48513"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR36"
FT                   /protein_id="BAH48513.1"
FT                   /translation="MTRSTVFRRAAIVLASAAALGMLSSGPASAAPVADFAKGAAELQA
FT                   LATEVSPAATAAVDALLGASVFIPKDVLEVGLTTPQDFMYPSPTLGCGVADKPATVTLA
FT                   SAQGGPNLFPQISATQLRFQAIPAYVAIPQSSELSVAWINLTTFQGGIVKLDDKLPIIN
FT                   TPLLSKIVDTGKGTVLATMFGTVGYADAVTCTVVPTVGTFTV"
     MTRSTVFRRA AIVLASAAAL GMLSSGPASA APVADFAKGA AELQALATEV SPAATAAVDA        60
     LLGASVFIPK DVLEVGLTTP QDFMYPSPTL GCGVADKPAT VTLASAQGGP NLFPQISATQ       120
     LRFQAIPAYV AIPQSSELSV AWINLTTFQG GIVKLDDKLP IINTPLLSKI VDTGKGTVLA       180
     TMFGTVGYAD AVTCTVVPTV GTFTV                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page