(data stored in ACNUC7421 zone)

EMBL: AP011115.PE27

AP011115.PE27        Location/Qualifiers
FT   CDS             complement(23623..24150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48274"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS25"
FT                   /protein_id="BAH48274.1"
FT                   /translation="MTKKENHHATRDNLRDWRTPLRVDGPTAPQPAVCHLVVGFDRHPA
FT                   SHAALTYAMDLAGRLDAFLHVAHIVDVDDMPVEPDRDDWEQRFADAVEAERTEACTMLA
FT                   TLPGNWTYYSREGNPAQLLTTIAEANDALMIIIGTSRGGVMSLFERFLGESVSSKLVHH
FT                   ARRPVLLVPVAG"
     MTKKENHHAT RDNLRDWRTP LRVDGPTAPQ PAVCHLVVGF DRHPASHAAL TYAMDLAGRL        60
     DAFLHVAHIV DVDDMPVEPD RDDWEQRFAD AVEAERTEAC TMLATLPGNW TYYSREGNPA       120
     QLLTTIAEAN DALMIIIGTS RGGVMSLFER FLGESVSSKL VHHARRPVLL VPVAG            175
//

If you have problems or comments...

PBIL Back to PBIL home page