(data stored in ACNUC7421 zone)

EMBL: AP011115.PE270

AP011115.PE270       Location/Qualifiers
FT   CDS             289150..290763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02700"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48517"
FT                   /db_xref="GOA:C1AR40"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR40"
FT                   /protein_id="BAH48517.1"
FT                   /translation="MVFGFGGCAAPPPALYDVAVSTGLLNPPLDRSTPPPVENPYRAPA
FT                   ILAASGAVVAAVLFWVVSGSLTDDAYISLSAARNLAVHGEWAIVHGLTANTSTSPLNVL
FT                   VLGALTFLTRLWGPGDPLLALGMLNVAVTALLGWVLARIGRRLGLGTFWAALAGALVVF
FT                   NPFVLSAVGLEVLLIPAAVAVMVWFALDGRAAWFGAAAGMAALVRLDLLVFVLVIAALS
FT                   PAIRGQVRRALGGFAAIAGPWYLFSWLVLGSALPDTFLIKQGQASDVGGYNYLTGPIMY
FT                   FESNPWRTVAAFGPAALGLVLLLLALFSYARYRTRPLSVPGAVLALGLSGALYYVAYVV
FT                   LDTVPYHWYYVAPATTLAMFAVLAAGIHWTAARNTTDRAAVGALAGLLAVLGAGAVYFD
FT                   VEGGLPWEAPPIFGNWASAQDYERVGRAVGTLVGDAPVRSPGEIGTLAYFCECVIVDEF
FT                   SDRGLVVEDRLVPRLAEASEPARTLLRANYAFFDYRLAPVNPAFDLRYGEGRGPGGPMS
FT                   WEVFSAARGVGHFTLVPLAG"
     MVFGFGGCAA PPPALYDVAV STGLLNPPLD RSTPPPVENP YRAPAILAAS GAVVAAVLFW        60
     VVSGSLTDDA YISLSAARNL AVHGEWAIVH GLTANTSTSP LNVLVLGALT FLTRLWGPGD       120
     PLLALGMLNV AVTALLGWVL ARIGRRLGLG TFWAALAGAL VVFNPFVLSA VGLEVLLIPA       180
     AVAVMVWFAL DGRAAWFGAA AGMAALVRLD LLVFVLVIAA LSPAIRGQVR RALGGFAAIA       240
     GPWYLFSWLV LGSALPDTFL IKQGQASDVG GYNYLTGPIM YFESNPWRTV AAFGPAALGL       300
     VLLLLALFSY ARYRTRPLSV PGAVLALGLS GALYYVAYVV LDTVPYHWYY VAPATTLAMF       360
     AVLAAGIHWT AARNTTDRAA VGALAGLLAV LGAGAVYFDV EGGLPWEAPP IFGNWASAQD       420
     YERVGRAVGT LVGDAPVRSP GEIGTLAYFC ECVIVDEFSD RGLVVEDRLV PRLAEASEPA       480
     RTLLRANYAF FDYRLAPVNP AFDLRYGEGR GPGGPMSWEV FSAARGVGHF TLVPLAG          537
//

If you have problems or comments...

PBIL Back to PBIL home page