(data stored in ACNUC7421 zone)

EMBL: AP011115.PE271

AP011115.PE271       Location/Qualifiers
FT   CDS             complement(290874..291620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48518"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR41"
FT                   /protein_id="BAH48518.1"
FT                   /translation="MSEHTHELTPTPRGPVCCVHVHGAAAYRVGYPPTSWEWTPWEFAT
FT                   DGRFTGRWDDPAGVWRTLYVGATRLSCYLEVLAYARKSDELSTALDEIVDNDGDDEWPT
FT                   IAPGRVPRSWMAARITGSGVISGWFVVPGDAETMATLRIGFRALAIRLGLADLDTAAIR
FT                   DGRPRVLTQAISQWINTLTGPDGEPVAGVQFDSRHGDGLVLWALYERPGDRRVSSRVTP
FT                   LEYGPVRENDPDLIEAMRLHNLVWED"
     MSEHTHELTP TPRGPVCCVH VHGAAAYRVG YPPTSWEWTP WEFATDGRFT GRWDDPAGVW        60
     RTLYVGATRL SCYLEVLAYA RKSDELSTAL DEIVDNDGDD EWPTIAPGRV PRSWMAARIT       120
     GSGVISGWFV VPGDAETMAT LRIGFRALAI RLGLADLDTA AIRDGRPRVL TQAISQWINT       180
     LTGPDGEPVA GVQFDSRHGD GLVLWALYER PGDRRVSSRV TPLEYGPVRE NDPDLIEAMR       240
     LHNLVWED                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page